DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and CAMKV

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_076951.2 Gene:CAMKV / 79012 HGNCID:28788 Length:501 Species:Homo sapiens


Alignment Length:388 Identity:152/388 - (39%)
Similarity:243/388 - (62%) Gaps:29/388 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DLKELNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKEESLENEIRV 81
            |.|..|:...:.::|:|..::.|..|.|:..|:.| :.|:....|...|:..:...::.:|||.:
Human    10 DKKNYNQPSEVTDRYDLGQVIKTEEFCEIFRAKDK-TTGKLHTCKKFQKRDGRKVRKAAKNEIGI 73

  Fly    82 LRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDAS 146
            |:               .:.||||:||::.:..:.:.::.:||.||.|:||.|:::|.|:|:|.|
Human    74 LK---------------MVKHPNILQLVDVFVTRKEYFIFLELATGREVFDWILDQGYYSERDTS 123

  Fly   147 HLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDSGIMATACGTPGYV 211
            :::||:||||.|:|...:|||:||.|||:||:...:|||:||||.|:|:| :|::...||||.|:
Human   124 NVVRQVLEAVAYLHSLKIVHRNLKLENLVYYNRLKNSKIVISDFHLAKLE-NGLIKEPCGTPEYL 187

  Fly   212 APEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDE--------NDANLFAQILKGDFEFDSPYW 268
            ||||:.::.||:.||.|:||||.||||.|.||||:|        :|.|||.:||.||:|||||||
Human   188 APEVVGRQRYGRPVDCWAIGVIMYILLSGNPPFYEEVEEDDYENHDKNLFRKILAGDYEFDSPYW 252

  Fly   269 DEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKNFAKSRWKQAY 333
            |:||::||..:..||.|..::|.|.::|:.|.|||||.||.:||...|..|::||||:::||:|.
Human   253 DDISQAAKDLVTRLMEVEQDQRITAEEAISHEWISGNAASDKNIKDGVCAQIEKNFARAKWKKAV 317

  Fly   334 YAATVIRQMQRMALNSNSNANFDSSNSSNQDSTTPTAATGAWTSNVLSSQQSVQSHAQEMNKS 396
            ...|::::::....:|.:.|    .::|..|:.||.||.||..:....:..:.:..|....||
Human   318 RVTTLMKRLRAPEQSSTAAA----QSASATDTATPGAAGGATAAAASGATSAPEGDAARAAKS 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 117/281 (42%)
S_TKc 31..302 CDD:214567 117/278 (42%)
CAMKVNP_076951.2 STKc_CaMK_like 22..286 CDD:270990 117/280 (42%)
S_TKc 24..286 CDD:214567 117/278 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..501 13/54 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 1 1.000 - - FOG0000163
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24347
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X46
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.