DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and phkg2

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_012825992.1 Gene:phkg2 / 779740 XenbaseID:XB-GENE-994728 Length:395 Species:Xenopus tropicalis


Alignment Length:313 Identity:113/313 - (36%)
Similarity:170/313 - (54%) Gaps:37/313 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KKAKAKDLKELNKQVSIEE---KYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIID-------K 65
            :.|:|:|  ||......:|   ||:...::|.|..|.||....::: |..:|||||:       .
 Frog     3 RDAEARD--ELPDWAGAKEFYQKYDPKEIIGRGVSSTVRRCIHRET-GRQYAVKIIEVTPERLSP 64

  Fly    66 KALKGKEESLENEIRVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGEL 130
            :.||....|...|:.:|...|              .||:|:.|:::||..:.::||.:|:..|||
 Frog    65 EQLKEVRLSTAKEMEILHHVS--------------NHPSIISLIDSYESSTFIFLVFDLMKRGEL 115

  Fly   131 FDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLS-K 194
            ||.:.||.:.:||:...::|.:||||.|:|...:|||||||||:|.   ||...|.:||||.| .
 Frog   116 FDYLTEKVTLSEKETRCIMRSLLEAVTYLHSNNIVHRDLKPENILM---DDCLNIKLSDFGFSCI 177

  Fly   195 MEDSGIMATACGTPGYVAPEVL------AQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLF 253
            ::.:..:...||||||:|||:|      ....||:.||:|:.|||.:.||.|.|||:......:.
 Frog   178 LKPTEKLRELCGTPGYLAPEILKCSMDETHPGYGREVDLWACGVIMFTLLAGSPPFWHRKQMLML 242

  Fly   254 AQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNE 306
            ..|:.|.|:|.||.||:.|.:.|..|..|:.|..|||.|.:|||.|.:...::
 Frog   243 RMIMDGRFQFGSPEWDDRSSTVKDLICRLLEVCPEKRLTAEQALQHPFFQSHQ 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 108/290 (37%)
S_TKc 31..302 CDD:214567 106/284 (37%)
phkg2XP_012825992.1 STKc_PhKG2 13..291 CDD:271083 108/295 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.