DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and uhmk1

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001070127.1 Gene:uhmk1 / 767721 ZFINID:ZDB-GENE-060929-1014 Length:410 Species:Danio rerio


Alignment Length:232 Identity:64/232 - (27%)
Similarity:100/232 - (43%) Gaps:62/232 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YNLHGLLGTGAFSEV-RLAESKDSPGEHFAVK--IIDKKALKGKEESLENEIRVLRRFSANHFDG 92
            :|:...||.|..:.| |::..:.:.    |||  .:|.   :|.:.....|..||.:...     
Zfish    24 WNVQARLGQGVSASVYRVSSGRATS----AVKEFQVDP---QGGDYGYLKESSVLEKIQG----- 76

  Fly    93 KCLNGTRLTHPNIVQLLETYEDKSKV-----YLVMEL--VTGGELFDRIVEKGSYTEKDASHLIR 150
                     |.|||.|...:.:.:..     .|::||  |:..||..|...:| ::.....|..|
Zfish    77 ---------HKNIVTLYGMFTNHNPFGVATHCLLLELLDVSVSELLVRASNQG-HSMWLIQHCAR 131

  Fly   151 QILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDSGIMATACG--------T 207
            .:|||:.::|.:|.||.||||.|:|:.:.|:..|::  |||||..|         |        |
Zfish   132 DVLEALTFLHREGFVHADLKPRNVLWSADDECFKLI--DFGLSFKE---------GHQDVKYIQT 185

  Fly   208 PGYVAPEVLAQKPYGK-----------AVDVWSIGVI 233
            .||.|||...|....:           |||:||:|::
Zfish   186 DGYRAPEAELQNSLAQAGVESDSGCTTAVDLWSLGIV 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 64/232 (28%)
S_TKc 31..302 CDD:214567 64/232 (28%)
uhmk1NP_001070127.1 STKc_KIS 23..299 CDD:270922 64/232 (28%)
S_TKc 24..295 CDD:214567 64/232 (28%)
RRM_UHMK1 309..396 CDD:240911
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.