DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and dclk1

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_012812605.1 Gene:dclk1 / 733926 XenbaseID:XB-GENE-960590 Length:753 Species:Xenopus tropicalis


Alignment Length:366 Identity:144/366 - (39%)
Similarity:211/366 - (57%) Gaps:35/366 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKEESLENEIRVLRRFSANH 89
            |||.|:|.:...:|.|.|:.|:....: |.|..:|:|||:|...:|||..::||:.:||      
 Frog   397 VSISERYKVGRTIGDGNFAIVKECIER-STGREYALKIINKSKCRGKEHMIQNEVSILR------ 454

  Fly    90 FDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILE 154
                     |:.|||||.|:|..:..|::|||||||.||:|||.|.....|||:||:.::..::.
 Frog   455 ---------RVKHPNIVLLIEEMDMPSELYLVMELVKGGDLFDAITSTNKYTERDANGMLYNLMS 510

  Fly   155 AVDYMHEQGVVHRDLKPENLLYYSPDDDSK-IMISDFGLSKMEDSGIMATACGTPGYVAPEVLAQ 218
            |:.|:|...:||||:||||||.|...|.|| :.:.||||:.:.| |.:.|.||||.|||||::|:
 Frog   511 AIKYLHSLNIVHRDIKPENLLVYEHQDGSKSLKLGDFGLATVVD-GPLYTVCGTPTYVAPEIIAE 574

  Fly   219 KPYGKAVDVWSIGVISYILLCGYPPFYDENDAN--LFAQILKGDFEFDSPYWDEISESAKHFIKN 281
            ..||..||:|:.|||:||||||:|||....|..  ||.|||.|..:|.|||||.:|:|||..|..
 Frog   575 TGYGLKVDIWAAGVITYILLCGFPPFRGSGDDQEVLFDQILMGHMDFPSPYWDNVSDSAKELITM 639

  Fly   282 LMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKNF---AKSRWKQA---YYAATVI- 339
            ::.|.|::||:..:.|.|.|::.:.........:|:.::||:|   .|.....|   ..|.|.: 
 Frog   640 MLQVDVDQRYSALKVLEHPWVNDDGLPENEYPLSVAGKIKKHFNTGPKPNCNSAGVNVIATTALD 704

  Fly   340 --RQMQRMALNSNSNANFDSS------NSSNQDSTTPTAAT 372
              ||:.|...|.:....|.|.      ||.::|.:..::.|
 Frog   705 KERQVFRRRRNQDVRYRFGSHQAAPEFNSESEDYSPSSSET 745

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 123/276 (45%)
S_TKc 31..302 CDD:214567 121/273 (44%)
dclk1XP_012812605.1 DCX1_DCLK1 55..143 CDD:340660
DCX2 182..265 CDD:340589
STKc_DCKL1 396..663 CDD:271085 126/282 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.