DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and TRIO

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_009049.2 Gene:TRIO / 7204 HGNCID:12303 Length:3097 Species:Homo sapiens


Alignment Length:352 Identity:103/352 - (29%)
Similarity:162/352 - (46%) Gaps:54/352 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DSGKKAKAKDLKELNKQV---------SIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKII 63
            |.|..:.:..|:.|...:         :.:..|:....||.|.||.|:..:.|.:. ...|.|.:
Human  2764 DMGSASSSASLRVLGPGMDGIMVTWKDNFDSFYSEVAELGRGRFSVVKKCDQKGTK-RAVATKFV 2827

  Fly    64 DKKALKGKEESLENEIRVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGG 128
            :||.:  |.:.:.:|:.:|:               .|.||.:|.||:|:|..:...||:|:...|
Human  2828 NKKLM--KRDQVTHELGILQ---------------SLQHPLLVGLLDTFETPTSYILVLEMADQG 2875

  Fly   129 ELFDRIVEKGSYTE-KDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDS----KIMIS 188
            .|.|.:|..||.|| |..:|| .::||||.|:|...:.|.||||||:|.    |:|    .|.::
Human  2876 RLLDCVVRWGSLTEGKIRAHL-GEVLEAVRYLHNCRIAHLDLKPENILV----DESLAKPTIKLA 2935

  Fly   189 DFG-LSKMEDSGIMATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANL 252
            ||| ..::..:..:....|.|.:.|||::...|.....|.||:||::|:||.|..||.|::....
Human  2936 DFGDAVQLNTTYYIHQLLGNPEFAAPEIILGNPVSLTSDTWSVGVLTYVLLSGVSPFLDDSVEET 3000

  Fly   253 FAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGT-- 315
            ...|.:.||.|...|:..:|:.||.|:..|:.....||.:...||...|:......|..:..|  
Human  3001 CLNICRLDFSFPDDYFKGVSQKAKEFVCFLLQEDPAKRPSAALALQEQWLQAGNGRSTGVLDTSR 3065

  Fly   316 ---VSEQLK-----------KNFAKSR 328
               ..|:.|           |||.:||
Human  3066 LTSFIERRKHQNDVRPIRSIKNFLQSR 3092

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 89/279 (32%)
S_TKc 31..302 CDD:214567 89/276 (32%)
TRIONP_009049.2 SEC14 69..204 CDD:214706
SPEC 230..445 CDD:238103
Spectrin 1 311..418
SPEC 341..566 CDD:238103
Spectrin 2 538..644
SPEC 567..783 CDD:238103
SPEC 787..1014 CDD:238103
Spectrin 3 878..984
SPEC 908..1137 CDD:238103
Spectrin 4 1109..1216
SPEC 1143..1243 CDD:197544
RhoGEF 1295..1465 CDD:238091
PH1_Kalirin_Trio_like 1472..1594 CDD:270060
PH 1505..1590 CDD:278594
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1601..1650
SH3_Kalirin_1 1659..1718 CDD:212786
SH3-RhoG_link 1715..1972 CDD:293215
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1779..1906
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1927..1965
RhoGEF 1970..2143 CDD:238091
PH2_Kalirin_Trio_p63RhoGEF 2148..2286 CDD:270061
PH 2175..2271 CDD:278594
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2287..2552
SH3_Kalirin_2 2555..2613 CDD:212787
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2639..2660
I-set 2685..2776 CDD:254352 3/11 (27%)
Ig 2699..2776 CDD:299845 3/11 (27%)
STKc_Trio_C 2788..3050 CDD:271015 89/284 (31%)
S_TKc 2796..3050 CDD:214567 89/276 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.