DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and RGD1565323

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001103105.1 Gene:RGD1565323 / 691300 RGDID:1565323 Length:121 Species:Rattus norvegicus


Alignment Length:120 Identity:27/120 - (22%)
Similarity:45/120 - (37%) Gaps:22/120 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 KHFIKNLMCVTVEKRYTCKQALGHAWISGNEA---SSRNIHGTVS-------EQLKK-NFAKSRW 329
            |..:|:..||.:.|..|          .|:|:   .|..|..|.|       |::.. :.:....
  Rat     9 KGVLKSHDCVLIYKSET----------EGDESPTPDSSLIRLTTSMLKVKRLEEISSCHSSNPLE 63

  Fly   330 KQAYYAATVIRQMQRMALNSNSNANFDSSNSSNQDSTTPTAATGAWTSNVLSSQQ 384
            |.|::......:..:..|..|| :|.|..:..|:.:.|.....|..|..||.|.:
  Rat    64 KVAFFQCMEEVEKVKCFLEENS-SNLDLQSGDNERTVTSPKLRGPATDMVLYSNE 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 6/24 (25%)
S_TKc 31..302 CDD:214567 6/25 (24%)
RGD1565323NP_001103105.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.