DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and Stk33

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_008758045.2 Gene:Stk33 / 690861 RGDID:1590972 Length:508 Species:Rattus norvegicus


Alignment Length:403 Identity:133/403 - (33%)
Similarity:210/403 - (52%) Gaps:39/403 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDK-KALKGKEESLENEIRVLRR 84
            ::...||||.|....:||.|:|..|..|..|:: |..:|:|.::| ||.....:.||.|:.:|: 
  Rat   102 MDNGASIEEFYTFGRILGQGSFGMVIEATDKET-GAKWAIKKVNKEKAGSSAVKLLEREVNILK- 164

  Fly    85 FSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLI 149
                          .:.|.:|:.|.:.:|...|:||||||...|||.:.:.::|.::|.:...:|
  Rat   165 --------------TVKHQHIIHLEQVFESPQKMYLVMELCEDGELKEVLDQRGHFSESETRLII 215

  Fly   150 RQILEAVDYMHEQGVVHRDLKPENLLYYSP--DDDSK----IMISDFGLSKME----DSGIMATA 204
            :.:..|:.|:|.:.:||||||.||::..|.  ||:::    |.:|||||:..:    ...:|.|.
  Rat   216 QSLASAIAYLHSKDIVHRDLKLENIMVKSSFIDDNNEMNLNIKVSDFGLAVQKHGSRSESMMQTT 280

  Fly   205 CGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWD 269
            ||||.|:||||:....|.:..|:||||||.||||||.|||...::..||..|.||:.:|..|.||
  Rat   281 CGTPIYMAPEVINAHDYSQQCDIWSIGVIMYILLCGEPPFLANSEEKLFELIRKGELQFQDPVWD 345

  Fly   270 EISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLK--KNFAKS----- 327
            .:|:|||..:|.||.|....|.|.|:.|.:.|::||..||.. ...|.|.:|  ||..:|     
  Rat   346 SVSDSAKSALKQLMKVDPAHRITAKELLDNQWLTGNTLSSAR-PTNVLEMMKEWKNNPESDDDTK 409

  Fly   328 ---RWKQAYYAATVIRQMQRMALNSNSNANFDSSNSSNQDSTTPTAATGAWTSNVLSSQQSVQSH 389
               ..:|.........:::..|.|.|.:.:..|.|....::..|.|.:...:.:..:|.:.:.:.
  Rat   410 ADKETEQHTEEKLKHNKIEEKAPNVNHSPSAKSVNQPTDEAKKPDADSVDMSPSDSTSYKLISAE 474

  Fly   390 AQ-EMNKSGGSTN 401
            .: |..||.||.:
  Rat   475 IKAEPEKSSGSVS 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 107/284 (38%)
S_TKc 31..302 CDD:214567 104/281 (37%)
Stk33XP_008758045.2 PKc_like 110..378 CDD:419665 105/283 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.