DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and Dapk3

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_006241053.1 Gene:Dapk3 / 64391 RGDID:621766 Length:464 Species:Rattus norvegicus


Alignment Length:309 Identity:110/309 - (35%)
Similarity:167/309 - (54%) Gaps:31/309 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPLFGKKDSGKKAKAKDLKELNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDK 65
            :|...:|||....        .:|..:|:.|.:...||:|.|:.||..:.|.: |..:|.|.|.|
  Rat     7 VPRILQKDSAMST--------FRQEDVEDHYEMGEELGSGQFAIVRKCQQKGT-GMEYAAKFIKK 62

  Fly    66 KALKG-----KEESLENEIRVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELV 125
            :.|..     ..|.:|.|:.:||               .:.||||:.|.:.:|:|:.|.|::|||
  Rat    63 RRLPSSRRGVSREEIEREVSILR---------------EIRHPNIITLHDVFENKTDVVLILELV 112

  Fly   126 TGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDS-KIMISD 189
            :||||||.:.||.|.||.:|:..::|||:.|.|:|.:.:.|.||||||::.......| :|.:.|
  Rat   113 SGGELFDFLAEKESLTEDEATQFLKQILDGVHYLHSKRIAHFDLKPENIMLLDKHAASPRIKLID 177

  Fly   190 FGLS-KMEDSGIMATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLF 253
            ||:: ::|.........|||.:||||::..:|.|...|:||||||:||||.|..||..|......
  Rat   178 FGIAHRIEAGSEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETL 242

  Fly   254 AQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWI 302
            ..|...:::||..|:...||.||.||:.|:....::|.|..|:|.|:||
  Rat   243 TNISAVNYDFDEEYFSSTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 103/280 (37%)
S_TKc 31..302 CDD:214567 102/277 (37%)
Dapk3XP_006241053.1 STKc_DAPK 23..291 CDD:271007 103/283 (36%)
S_TKc 29..291 CDD:214567 102/277 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.