DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and dapk2a

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001116536.2 Gene:dapk2a / 571352 ZFINID:ZDB-GENE-080402-8 Length:484 Species:Danio rerio


Alignment Length:372 Identity:123/372 - (33%)
Similarity:192/372 - (51%) Gaps:33/372 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGK-----EESLENEIRVL 82
            ||..:|:.:.:...||:|.|:.|:....|.| |..||.|.|.|:.....     .|.:|.|:.:|
Zfish     5 KQQQVEDFFEIGEELGSGQFAIVKQCREKSS-GRDFAAKFIKKRQSNASRRGVLREEIEREVNIL 68

  Fly    83 RRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASH 147
            :               ::.|||||.|.:.:|:|:.|.|::|||:||||||.:.:|.|.:|::|:.
Zfish    69 Q---------------QIHHPNIVMLHDVFENKTDVVLILELVSGGELFDFLAQKESLSEEEATQ 118

  Fly   148 LIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDD-SKIMISDFGLSKMEDSGI-MATACGTPGY 210
            .|:||||.|.|:|.:.:.|.||||||::....:.. .:|.:.||||:.....|: .....|||.:
Zfish   119 FIKQILEGVHYLHSRNIAHFDLKPENIMLLDKNAPLPRIKLIDFGLAHKIAEGVEFKNIFGTPEF 183

  Fly   211 VAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESA 275
            ||||::..:|.|...|:||:|||:||||.|..||..|...:....|...::|||..::...||.|
Zfish   184 VAPEIVNYEPLGLEADMWSVGVITYILLSGASPFLGETKQDTLGNISAMNYEFDDEFFGHTSELA 248

  Fly   276 KHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKNFAKSRWKQAYYAATVIR 340
            |:||:.|:....:||.|.:.||.||||..||...........::.::.....|.|:     ..|:
Zfish   249 KNFIRQLLEKDTKKRLTIQDALNHAWIKSNEHKEDRNKAPERKRERRQLKTKRLKE-----YTIK 308

  Fly   341 QMQRMALNSNSNANFDSSNSSNQDSTTPTAATGAWTSNVLSSQQSVQ 387
            ....|..| |:..||:......:|   .:|..|.: ..:.|:..|:|
Zfish   309 SHSSMPPN-NTYINFERFAQVEED---VSAMEGTF-CQLASAHDSLQ 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 102/280 (36%)
S_TKc 31..302 CDD:214567 102/277 (37%)
dapk2aNP_001116536.2 PKc_like 7..275 CDD:304357 103/283 (36%)
S_TKc 13..275 CDD:214567 102/277 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.