DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and mylk3

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001099057.1 Gene:mylk3 / 561635 ZFINID:ZDB-GENE-030131-3497 Length:715 Species:Danio rerio


Alignment Length:369 Identity:121/369 - (32%)
Similarity:190/369 - (51%) Gaps:52/369 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DSGKKAKAKDLKELN-----------------------KQVSIEEKY--NLHGLLGTGAFSEV-R 46
            |..:|:||..|:::.                       |||.|...|  |...:||.|.|.:| :
Zfish   356 DEDEKSKAAPLRKVESTLLIIDDSPPLPAPFDHRIVSAKQVPINSYYAVNPVEVLGGGRFGQVHK 420

  Fly    47 LAESKDSPGEHFAVKIIDKKALKGKEESLENEIRVLRRFSANHFDGKCLNGTRLTHPNIVQLLET 111
            .||.  |.|...|.|||..:.:|.::| ::|||.|:               .:|.|.|::||.:.
Zfish   421 CAEL--SSGLTLAAKIIKVRGMKERDE-VKNEIGVM---------------NQLNHVNLIQLYDA 467

  Fly   112 YEDKSKVYLVMELVTGGELFDRIVEKGSY--TEKDASHLIRQILEAVDYMHEQGVVHRDLKPENL 174
            :|.::.:.|:||.|.|||||:||::: ||  ||.||....|||.|.|.|:|:|.::|.||||||:
Zfish   468 FESRTNLTLIMEYVEGGELFERIIDE-SYQLTELDAIVFTRQICEGVQYLHQQYILHLDLKPENI 531

  Fly   175 LYYSPDDDSKIMISDFGLS-KMEDSGIMATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILL 238
            |..: ...::|.|.||||: |......:....|||.::||||:.........|:||:|||:|:||
Zfish   532 LCVN-STGNQIKIIDFGLARKYRPREKLKVNFGTPEFLAPEVVNYDFVSFPTDMWSVGVITYMLL 595

  Fly   239 CGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWIS 303
            .|..||..:|||.....||...:|||:..::.:||.||.||.:|:......|.:....:.|:|::
Zfish   596 SGLSPFMGDNDAETMNNILHAKWEFDTEAFENVSEEAKDFISSLLVSAKCSRLSASGCMKHSWLN 660

  Fly   304 GNEASSRNIHGTVSEQL---KKNFAKSRWKQAYYAATVIRQMQR 344
            ..|..::.....:..|:   :...|..:||:.:||.....:::|
Zfish   661 NLEDKAKMYKVRLKSQMMLQRYLVAHRQWKKHFYAVAAANRLKR 704

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 104/279 (37%)
S_TKc 31..302 CDD:214567 103/276 (37%)
mylk3NP_001099057.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 67..114
STKc_MLCK3 399..659 CDD:271094 103/279 (37%)
S_TKc 407..659 CDD:214567 101/271 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.