DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and si:dkey-240h12.4

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_021323963.1 Gene:si:dkey-240h12.4 / 555536 ZFINID:ZDB-GENE-070705-406 Length:361 Species:Danio rerio


Alignment Length:368 Identity:113/368 - (30%)
Similarity:191/368 - (51%) Gaps:46/368 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKG-----KEESLENEIRVLRRF 85
            ::|:.|.:..:||:|.|.:||....: :.|..:|.|.:..|...|     :.:|:|.|:.:|:  
Zfish     8 NVEDLYEIGNVLGSGHFGQVREVRER-ATGVLWAGKFLKLKKGAGSRLGLERKSVEKEVEILQ-- 69

  Fly    86 SANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIR 150
                         .|.|.||:.:.:.:|.::::.|::||:.||||||.|.||.:.||.:|...::
Zfish    70 -------------SLQHQNIMAIRDVFESRAEIVLIVELIKGGELFDFIAEKENLTETEAIEFMK 121

  Fly   151 QILEAVDYMHEQGVVHRDLKPENLLY---YSPDDDSKIMISDFGLS-------KMEDSGIMATAC 205
            ||||.|:|||::.|.|.||||||::.   :.|..|.||:  |||::       :.:..|      
Zfish   122 QILEGVNYMHQKNVAHFDLKPENIMLSDKHDPHPDIKII--DFGMAHHFIQGEEYKSLG------ 178

  Fly   206 GTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDE 270
            |||.|:|||::..:|.|.|.|:||||||:||||.|..||..|.|......|:..::||:..::.:
Zfish   179 GTPQYIAPEIINYEPLGTAADMWSIGVITYILLSGLSPFQGETDEETLRNIVSMNYEFEPHFFSQ 243

  Fly   271 ISESAKHFIKNLMCVTVEKRYTCKQALGHAWI---SGNEASSRNIHGTVSEQLKKNFAKSRWKQA 332
            .:..||.||:.|:.....:|.|.::.|.|.||   :..:.:.||......:..||..|:.:||.:
Zfish   244 TTNMAKDFIQKLLVKDQSERMTAEECLIHPWIKPLNRTQIAKRNRSSINMKNFKKFNARRKWKMS 308

  Fly   333 YYAATVIRQMQRMAL----NSNSNANFDSSNSSNQDSTTPTAA 371
            :...:...::.|:.:    ............|..:|:.|..|:
Zfish   309 FNMVSACNRLCRLQILCKARGTEQQELRDCESDQEDTGTKPAS 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 99/288 (34%)
S_TKc 31..302 CDD:214567 98/285 (34%)
si:dkey-240h12.4XP_021323963.1 PKc_like 7..275 CDD:328722 99/290 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.