DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and camkvl

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_021325614.1 Gene:camkvl / 553431 ZFINID:ZDB-GENE-090311-58 Length:762 Species:Danio rerio


Alignment Length:399 Identity:147/399 - (36%)
Similarity:232/399 - (58%) Gaps:32/399 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KDLKELNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKEESLENEIR 80
            :|.:..|....|.:||.:..:|....|.|:.|.:.:.:...:...|.:.|...|.: ::.:|||.
Zfish    15 RDGRTYNSLSDITDKYEIGQVLKAKEFCELCLVKERQTDKVYVCKKFLKKDGRKVR-KAAKNEIM 78

  Fly    81 VLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDA 145
            :|:               .:.||||:||::.:|.:.:.:::.||.|||::||.|:::|:|||:||
Zfish    79 ILK---------------MVKHPNILQLIDAFETRKEFFIIQELATGGDVFDWILDQGNYTERDA 128

  Fly   146 SHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDSGIMATACGTPGY 210
            :::|||:||||.|:|...:|||:||.|||:||...:.:|:::.||.||:.| :|.:...||||.|
Zfish   129 ANVIRQVLEAVAYLHSLNIVHRNLKLENLMYYRESNHNKVVLRDFYLSRFE-NGSITEPCGTPEY 192

  Fly   211 VAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDAN--------LFAQILKGDFEFDSPY 267
            :||||:|:..||:.||.|::|||.||||.|.||||||.:..        :|.:|:.|:|||||||
Zfish   193 LAPEVVARHRYGRPVDCWAVGVIMYILLSGNPPFYDETEEENTDMHNRIIFCRIVGGEFEFDSPY 257

  Fly   268 WDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKNFAKSRWKQA 332
            ||:||.:||..:...|.|....|.|.:.||.|.||:||.||.:|:...|..|.:|||||::|::.
Zfish   258 WDDISPAAKELVCRFMEVDQMLRITAQDALTHEWIAGNGASEKNLKEGVCAQFEKNFAKAKWREL 322

  Fly   333 YYAATVIRQMQRMA---LNSNSNA---NFDSSNSSNQDSTTPTAATGAWTSNVLSSQQSVQSHAQ 391
            ..|..|...|||:.   :.|:..|   ..:...:...|.......:|..::..:|.:.||:|...
Zfish   323 KKAIRVTTFMQRLRATDIGSSDGAVEGQAEGVKADGLDGKGIQTDSGGVSAGSVSHEVSVESRPT 387

  Fly   392 EMNKSGGST 400
            | |:..|.|
Zfish   388 E-NQEAGQT 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 113/281 (40%)
S_TKc 31..302 CDD:214567 111/278 (40%)
camkvlXP_021325614.1 PKc_like 28..292 CDD:328722 112/280 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24347
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.