DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and stk33

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_031755965.1 Gene:stk33 / 549733 XenbaseID:XB-GENE-940061 Length:480 Species:Xenopus tropicalis


Alignment Length:432 Identity:121/432 - (28%)
Similarity:206/432 - (47%) Gaps:49/432 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPLFGKKDSGKKAKAKDLKELNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDK 65
            ||....:|:..::|....: ::.:.:|::.|.....||.|:|..|..|..|::..:....|:..:
 Frog    13 MPSQWSRDNSAESKVPHTR-MDDEAAIQQIYTFGKKLGQGSFGVVIEATHKETATKWAMKKVNRE 76

  Fly    66 KALKGKEESLENEIRVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGEL 130
            ||.....:.||.|:.:|:               |:.|.:|:.|.|.:|...::|||.||..||||
 Frog    77 KAGSSAVKLLEREVSILK---------------RVKHDHIIHLEEVFETPKRMYLVTELCEGGEL 126

  Fly   131 FDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPD--DDSK----IMISD 189
            .:.:..|...:|.:..|:||.:..|:.|:|.:|:||||||.||:|..|.|  |:.:    |.::|
 Frog   127 REILHRKKCLSEAETRHVIRSLGSAIAYLHRKGIVHRDLKLENILVKSNDGADNEELILNIKVTD 191

  Fly   190 FGLSKMEDSGI-----MATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDEND 249
            |||: ::..|:     :.:.||||.|:||||:....|.:..|:||.|||.|:||.|.|||...::
 Frog   192 FGLA-VQKGGVGSENMLQSTCGTPIYMAPEVINDHDYSQQCDIWSTGVIMYMLLSGNPPFMAGSE 255

  Fly   250 ANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEA------- 307
            ..||..|.:|:.:|....|..||.:||..::.|:.|....|.|..:.|.:.||:|...       
 Frog   256 EKLFEDIRRGELKFSDAVWQGISNAAKDVLQRLLKVDPAHRITANELLDNPWITGETTLVQRPTN 320

  Fly   308 ------SSRNIHGTVSEQLKKNFAKSRWKQAYYAATVIRQMQRMALNSNSNANFDS-SNSSNQDS 365
                  :.:|:.....:.|.:|.............||..:....:.|..|....|: ::||:...
 Frog   321 VLELMNAWKNLDADELDHLDENSNGLSLAHLIDIPTVEERASPASSNGTSEMGLDTETDSSSSKP 385

  Fly   366 TTPT-------AATGAWTSNVLSSQQSVQSHAQEMNKSGGST 400
            :|||       ..:.:.||..:..:.|....|...:.:|.::
 Frog   386 STPTNQVTKKKTVSSSLTSRTVKKKSSTLKPASSPSTNGNTS 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 96/284 (34%)
S_TKc 31..302 CDD:214567 95/281 (34%)
stk33XP_031755965.1 PKc_like 40..308 CDD:419665 95/283 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.