DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and PHKG2

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_000285.1 Gene:PHKG2 / 5261 HGNCID:8931 Length:406 Species:Homo sapiens


Alignment Length:294 Identity:110/294 - (37%)
Similarity:163/294 - (55%) Gaps:32/294 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKEESLE-------NEIRVLRRFS 86
            :||:...::|.|..|.||....: :.|..|||||::..|.:...|.||       .|..:||:.:
Human    22 QKYDPKDVIGRGVSSVVRRCVHR-ATGHEFAVKIMEVTAERLSPEQLEEVREATRRETHILRQVA 85

  Fly    87 ANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQ 151
            .              ||:|:.|:::||..|.::||.:|:..|||||.:.||.:.:||:...::|.
Human    86 G--------------HPHIITLIDSYESSSFMFLVFDLMRKGELFDYLTEKVALSEKETRSIMRS 136

  Fly   152 ILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLS-KMEDSGIMATACGTPGYVAPEV 215
            :||||.::|...:|||||||||:|.   ||:.:|.:||||.| .:|....:...||||||:|||:
Human   137 LLEAVSFLHANNIVHRDLKPENILL---DDNMQIRLSDFGFSCHLEPGEKLRELCGTPGYLAPEI 198

  Fly   216 L------AQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISES 274
            |      ....|||.||:|:.|||.:.||.|.|||:......:...|::|.::|.||.||:.|.:
Human   199 LKCSMDETHPGYGKEVDLWACGVILFTLLAGSPPFWHRRQILMLRMIMEGQYQFSSPEWDDRSST 263

  Fly   275 AKHFIKNLMCVTVEKRYTCKQALGHAWISGNEAS 308
            .|..|..|:.|..|.|.|.:|||.|.:....|.|
Human   264 VKDLISRLLQVDPEARLTAEQALQHPFFERCEGS 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 108/285 (38%)
S_TKc 31..302 CDD:214567 107/284 (38%)
PHKG2NP_000285.1 STKc_PhKG2 13..291 CDD:271083 108/286 (38%)
Calmodulin-binding (domain-N). /evidence=ECO:0000250 306..330
Calmodulin-binding (domain-C). /evidence=ECO:0000250 346..370
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.