DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and mylk4b

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_021324306.1 Gene:mylk4b / 449707 ZFINID:ZDB-GENE-041001-128 Length:697 Species:Danio rerio


Alignment Length:305 Identity:110/305 - (36%)
Similarity:161/305 - (52%) Gaps:29/305 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KQVSIEEKYNLH--GLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKEESLENEIRVLRRF 85
            |...|...||::  .:||.|.|..|...|.|.| |...|.|||..::.|.| |.::.||.|:   
Zfish   406 KTHQITSYYNINKEEVLGGGRFGIVHKCEEKSS-GLILAAKIIKARSQKEK-EVVKCEIEVM--- 465

  Fly    86 SANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKG-SYTEKDASHLI 149
                        .:|.|.|::||...:|.:.::.||||.|.|||||:||:::. ..||.|....|
Zfish   466 ------------NQLNHANLIQLYAAFESRHEITLVMEYVDGGELFERIIDENYKLTELDTVLFI 518

  Fly   150 RQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLS-KMEDSGIMATACGTPGYVAP 213
            |||.|.:.|||:..::|.||||||:|..| .:.:|:.|.||||: :.:....:....|||.::||
Zfish   519 RQITEGLQYMHKMYILHLDLKPENILCIS-RETNKVKIIDFGLARRYKPREKLRVNFGTPEFLAP 582

  Fly   214 EVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHF 278
            ||:..:......|:||:|||:|:||.|..||..|:|......||...:.|:...:.:|||.||.|
Zfish   583 EVINYEFVSFPTDMWSLGVITYMLLSGLSPFLGEDDNETLNNILACQWSFEEAEFADISEEAKDF 647

  Fly   279 IKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKN 323
            |..|:..:...|.:..|:|.|.|:     |.|.:|..:..  |||
Zfish   648 ISRLLVKSKSWRMSASQSLKHPWL-----SDRGLHYRLHH--KKN 685

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 102/277 (37%)
S_TKc 31..302 CDD:214567 101/274 (37%)
mylk4bXP_021324306.1 STKc_MLCK4 411..671 CDD:271095 101/277 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.