DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and Lk6

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_651986.2 Gene:Lk6 / 44672 FlyBaseID:FBgn0017581 Length:1142 Species:Drosophila melanogaster


Alignment Length:470 Identity:141/470 - (30%)
Similarity:208/470 - (44%) Gaps:102/470 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KKDSGKKAKAKDLKELNKQVSIEEKYNLHG-LLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALK 69
            |::..||.:.|.:.......:.:|.|.|.| :||.||::.|:...:..:..| :|||:|||  :.
  Fly    92 KEEMQKKRRKKRISSSLHSSTFQELYKLTGEILGEGAYASVQTCVNIYTDLE-YAVKVIDK--IP 153

  Fly    70 GKEESLENEIRVLRRFSA-NHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDR 133
            |...:     ||.|.... :|..|         |..|:||:|.:||..|.|||.|.:.||.|..|
  Fly   154 GHARA-----RVFREVETFHHCQG---------HLGILQLIEFFEDDEKFYLVFEKINGGPLLSR 204

  Fly   134 IVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDS 198
            |.|...::|.:||.:|::|...:|::|::|:.||||||||:|....|....|.|.||.|.    |
  Fly   205 IQEHICFSEHEASQIIKEIASGLDFLHKKGIAHRDLKPENILCVKTDSLCPIKICDFDLG----S 265

  Fly   199 GI--------------MATACGTPGYVAPEVL-----AQKPYGKAVDVWSIGVISYILLCGYPPF 244
            ||              :.|..|:..::||||:     ....|.|..|:||:|||:||||||||||
  Fly   266 GIKFTTDISSPAATPQLLTPVGSAEFMAPEVVDLFVGEAHYYDKRCDLWSLGVIAYILLCGYPPF 330

  Fly   245 -----------YDEN----DANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCK 294
                       ..||    ...||..|.:|.|.|....|.::|:.||..|.||:......|.:.:
  Fly   331 SGNCGEDCGWNRGENCRTCQELLFESIQEGHFSFPEAEWHDVSDEAKDLISNLLVKKASNRLSAE 395

  Fly   295 QALGHAWISGNE----ASSRNIHG------TVSEQLKKNFAKSR-WKQAYYAATVIRQM------ 342
            ..|.|.||...|    ||.   ||      .....:::|...:| ..|...:|..::::      
  Fly   396 AVLNHPWIRMCEQEPPASK---HGRRHKALQTPSNIRRNHQSAREISQFAESAMAVKRVVLQHFS 457

  Fly   343 -------QRMALNSNSNANFDSSNSSNQDSTTPTAATGAWTSNVLSSQQSVQS------------ 388
                   :|..:...|.|..|:.:..|.:...|    |.:|.|  .||::..|            
  Fly   458 MRYDYMKERPNIYQPSQAYMDAYSDENYNPKPP----GHYTRN--RSQRNPASSLCGYGGRMSSM 516

  Fly   389 HAQEMNKSGGSTNAA 403
            |.|..|....|.||:
  Fly   517 HGQRANSRRSSRNAS 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 108/309 (35%)
S_TKc 31..302 CDD:214567 107/306 (35%)
Lk6NP_651986.2 STKc_Mnk 115..403 CDD:270992 108/308 (35%)
S_TKc 117..403 CDD:214567 107/306 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.