DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and camk2d1

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_009301756.1 Gene:camk2d1 / 445208 ZFINID:ZDB-GENE-040801-121 Length:591 Species:Danio rerio


Alignment Length:397 Identity:152/397 - (38%)
Similarity:222/397 - (55%) Gaps:46/397 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKE-ESLENEIRVLRRFSANHFDG 92
            ::|.|:..||.||||.||.. .|.|.|:.:|.|||:.|.|..:: :.||.|.|:.|         
Zfish    11 DEYQLYEELGKGAFSVVRRC-MKISTGQEYAAKIINTKKLSARDHQKLEREARICR--------- 65

  Fly    93 KCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVD 157
                  .|.|.|||:|.::..::...|||.:||||||||:.||.:..|:|.||||.|:||||||.
Zfish    66 ------LLKHANIVRLHDSISEEGVHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVL 124

  Fly   158 YMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDSGIMAT---ACGTPGYVAPEVLAQK 219
            :.|:.|||||||||||||..|....:.:.::||||: :|..|....   ..|||||::||||.::
Zfish   125 HCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLA-IEVQGDQQAWFGFAGTPGYLSPEVLRKE 188

  Fly   220 PYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMC 284
            ||||.||:|:.|||.||||.|||||:||:...|:.||..|.::|.||.||.::..||..|..::.
Zfish   189 PYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLT 253

  Fly   285 VTVEKRYTCKQALGHAWISGNEASSRNIH--GTVSEQLKKNFAKSRWKQA--------------- 332
            :...||.|..:||.|.||......:..:|  .|| |.|||..|:.:.|.|               
Zfish   254 INPAKRITAAEALKHPWICQRSTVASMMHRQETV-ECLKKFNARRKLKGAILTTMLATRNFSSKN 317

  Fly   333 -YYAATVIRQMQRMALNSNSNANFDSSNSSN---QDSTTPTAATGAWTSNVLSSQQSVQSHAQEM 393
             |.....:::.|...:::.::.|.:||.|:|   :|........ ::|.:.:.:::  |||:|:.
Zfish   318 PYKKPDGVKEPQTTVIHNPTDGNKESSESTNTTIEDEDIKVYRL-SYTPHRMFTRE--QSHSQQS 379

  Fly   394 NKSGGST 400
            ..|..|:
Zfish   380 CSSAASS 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 125/275 (45%)
S_TKc 31..302 CDD:214567 125/274 (46%)
camk2d1XP_009301756.1 STKc_CaMKII 11..302 CDD:270988 136/308 (44%)
S_TKc 13..271 CDD:214567 125/274 (46%)
CaMKII_AD 459..586 CDD:285524
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X46
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.