DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and CG31345

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_731744.1 Gene:CG31345 / 41576 FlyBaseID:FBgn0051345 Length:213 Species:Drosophila melanogaster


Alignment Length:225 Identity:46/225 - (20%)
Similarity:75/225 - (33%) Gaps:77/225 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 KEESLENEIRVLRRFSANHFDGKCLNGTRLT-----HPNIVQLLETY----EDKSKVYLVMELVT 126
            ||..|:|   :.:|..||..|...:...||.     ...|:.|..::    :|.||.....|...
  Fly     9 KEAELKN---LAKRELANGLDKDPIYKLRLQCFSRGATGILGLSRSFRVMDDDGSKSLSPEEFKK 70

  Fly   127 G-------------GELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYS 178
            |             .|:|.|....||........|::                  |:|       
  Fly    71 GVTDIGLDLTDSEIDEMFSRFDTDGSGNINMTEFLVK------------------LRP------- 110

  Fly   179 PDDDSKIMISDFGLSKMEDSGIMATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPP 243
            |.::|:|.|.:....||:.:|        .|.:....|.        :|:|:.        .:|.
  Fly   111 PMNNSRISIIEKAFDKMDANG--------DGQITVTDLK--------NVYSVR--------DHPK 151

  Fly   244 FY--DENDANLFAQILKGDFEFDSPYWDEI 271
            :.  :..:..:|.|.|| :||..:|..|.|
  Fly   152 YLSGEMTENQIFTQFLK-NFEVGAPNPDGI 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 46/225 (20%)
S_TKc 31..302 CDD:214567 46/225 (20%)
CG31345NP_731744.1 EF-hand_7 48..105 CDD:290234 11/56 (20%)
EFh 48..105 CDD:238008 11/56 (20%)
EFh 83..136 CDD:238008 16/85 (19%)
EF-hand_7 84..144 CDD:290234 17/100 (17%)
EF-hand_7 120..190 CDD:290234 17/86 (20%)
EFh 120..187 CDD:298682 17/86 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.