DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and stk17b

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_956829.1 Gene:stk17b / 393507 ZFINID:ZDB-GENE-040426-1499 Length:354 Species:Danio rerio


Alignment Length:300 Identity:95/300 - (31%)
Similarity:150/300 - (50%) Gaps:25/300 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SGKKAKAKDLKELNKQV---SIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKG 70
            ||..|.   |.|::..:   .::..:::...||.|.|:.|:....| :.|:.||.|.| ||..:|
Zfish    10 SGSSAL---LSEIHSHIHTDPLDTLFDIGKELGRGKFAVVKRCVEK-TTGKVFAAKFI-KKRRRG 69

  Fly    71 KE--ESLENEIRVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDR 133
            ::  ..:.:||.||.....|              |.:|.|...||....:.|::|...|||:|:.
Zfish    70 RDCRADVIHEIAVLEAAKNN--------------PRVVNLNAVYETDYDLVLMLEFAAGGEIFNH 120

  Fly   134 IVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLS-KMED 197
            .|......|...:.||||:||.:..:|:..|||.||||:|:|..|......|.|.||||: ::..
Zfish   121 CVSDELLPEGQITRLIRQMLEGIHLLHQSSVVHLDLKPQNILLTSLSPLGDIKIVDFGLARRLGS 185

  Fly   198 SGIMATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFE 262
            :|.:....|||.|||||:|..:|...|.|:||:|||:|:|:.|..||..::....|..:.:.:.|
Zfish   186 AGELREILGTPEYVAPEILNYEPITTATDLWSVGVITYMLVTGESPFAGDDKQETFLNVSQVNVE 250

  Fly   263 FDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWI 302
            :....:..:||.|..||:.|:....|.|.:....:.|.|:
Zfish   251 YSRETFSRVSELAVDFIRKLLVKAPEDRPSAADCMTHPWL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 89/276 (32%)
S_TKc 31..302 CDD:214567 89/273 (33%)
stk17bNP_956829.1 STKc_DRAK2 24..290 CDD:271100 89/281 (32%)
S_TKc 32..290 CDD:214567 89/273 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.