powered by:
Protein Alignment CaMKI and Pskh1
DIOPT Version :9
Sequence 1: | NP_524622.1 |
Gene: | CaMKI / 43792 |
FlyBaseID: | FBgn0016126 |
Length: | 405 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001102367.1 |
Gene: | Pskh1 / 364993 |
RGDID: | 1304648 |
Length: | 44 |
Species: | Rattus norvegicus |
Alignment Length: | 31 |
Identity: | 8/31 - (25%) |
Similarity: | 11/31 - (35%) |
Gaps: | 11/31 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 205 CGTPGYVAPEVLAQKPYGKAVDVWSIGVISY 235
|||....:|.. |.|.||:.:
Rat 3 CGTSKKSSPTF-----------VLSFGVLPF 22
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000163 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
1 |
1.000 |
- |
- |
|
X46 |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.910 |
|
Return to query results.
Submit another query.