DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and sqa

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster


Alignment Length:381 Identity:105/381 - (27%)
Similarity:174/381 - (45%) Gaps:53/381 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKII------DKKALKGKEESLENEI 79
            :|:.|...:.|::.|.:|.|.|..|.....| :.|...|.|.:      ||:       ::|.|:
  Fly    24 INRNVDAHKHYDVLGEVGRGKFGTVYKCRDK-ANGLQLAAKFVPIPKREDKR-------NVEREV 80

  Fly    80 RVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIV-EKGSYTEK 143
            .::               ..|.|..|:||...||.:..:.:|:||:.|||||||:| ::...||:
  Fly    81 EIM---------------NSLQHHLIIQLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTER 130

  Fly   144 DASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLS-KMEDSGIMATACGT 207
            .....|||:.||:.::|..|:||.||||||:|..: ...::|.|.||||: |.:....:....||
  Fly   131 VCRVFIRQVCEAMAFIHGNGIVHLDLKPENILVLT-QKGNRIKIIDFGLARKFDPDKRLRVLFGT 194

  Fly   208 PGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEIS 272
            |.:|||||:.........|:||:|||.|:|:.|..||..|||....:.:....::|:...::.||
  Fly   195 PEFVAPEVVNFDCISYGTDMWSVGVICYVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGIS 259

  Fly   273 ESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKNFAKSRWKQAYYAAT 337
            .....||..|:...:..|.|..:.:.|.|:....|::..  .|...:.....:|||.|..     
  Fly   260 PECLDFIAKLLAKDLSTRMTAAECMKHKWLQQRPATAAT--ATPITKAASAASKSRLKSV----- 317

  Fly   338 VIRQMQRMALNSNSNANFDSSNSSNQDSTTPTAATGAWTSNVLSSQQSVQSHAQEM 393
                   ..:.:.|.::.||:.:...:......|       |..::|..|...:|:
  Fly   318 -------SPVTAPSESSEDSTETIEDEDDEEEVA-------VQQAKQKDQQQDEEL 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 88/281 (31%)
S_TKc 31..302 CDD:214567 88/278 (32%)
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 88/278 (32%)
STKc_MLCK 40..289 CDD:271005 86/272 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24347
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.