DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and Caps2

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_011241801.1 Gene:Caps2 / 353025 MGIID:2441980 Length:612 Species:Mus musculus


Alignment Length:444 Identity:73/444 - (16%)
Similarity:129/444 - (29%) Gaps:187/444 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DLKELNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKEESLENE--- 78
            |.|.|.:|...:..|....:........|.:.:.|.:..|...:..:.:..:...|:.|..:   
Mouse   186 DRKALLQQGYADSPYGRQSITRKSDVETVAIEKKKQTVAEQMMMDHLSRAVISDPEQDLNTKNQE 250

  Fly    79 ------------IRVLRR------------FSAN------HFDGKCLN-----------GTRLTH 102
                        :||.||            .:.|      .|||:.|:           |....|
Mouse   251 SSRVPPDSERAPLRVRRRTLHETKIRTNSALTENDLSQKVEFDGRVLSRNGRDACRELIGFFFAH 315

  Fly   103 PNIVQLLETYE--------------------------DKSKVYLVMELVTGGEL----------- 130
            .   |.|..||                          .|.|.|.:.::.||..|           
Mouse   316 D---QSLTVYEYRMFGKNRTSVLPFIKKDIYHHQCGRRKGKQYELGDVYTGATLTFLSCDQPSLP 377

  Fly   131 ---------------FDRI------VEKGSYTEKDA------SHLIRQILEAVDYMHEQGVVHRD 168
                           .|::      .....:.|::|      ..|:.|.::  |.:.||  :|: 
Mouse   378 KTIKENALLRLRITNIDQVALNSLKAASAEHGEEEAVSPEAHDQLVLQAIQ--DKLKEQ--LHK- 437

  Fly   169 LKPENLL-----YYSPDDDSKIMISDFGLSKMEDSGIMATACGTPGYVAPEVLAQKPYGKAVDVW 228
             |...:|     |:.            ||.| |.:|::..|               .:.:|:..:
Mouse   438 -KGARILTGLGRYFQ------------GLDK-EGNGLLEKA---------------DFQQALKTF 473

  Fly   229 SIGVISYILLCGYPPFYDENDANLFAQILKG--------DF-EFDSPYWDEISESAKHFIKN--- 281
            .:.|             .|.|...|..||:|        |: ||....:.|::|..|.|::.   
Mouse   474 HLEV-------------SEQDFESFWLILQGYGHSKNKVDYGEFKRAIFGEMNEYRKSFVRKAFM 525

  Fly   282 ---------LMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKNFAK 326
                     :..:.:.|.|..|:   |..:....::...|..:..|.||...:|
Mouse   526 QLDFNKTGIVSVIDIRKCYCAKK---HPRVISGHSTEEEIKSSFLETLKGTCSK 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 64/407 (16%)
S_TKc 31..302 CDD:214567 64/404 (16%)
Caps2XP_011241801.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.