DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and camk1ga

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_956260.1 Gene:camk1ga / 335654 ZFINID:ZDB-GENE-030131-7594 Length:426 Species:Danio rerio


Alignment Length:332 Identity:184/332 - (55%)
Similarity:243/332 - (73%) Gaps:23/332 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KELN-----KQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKEESLENE 78
            ||:|     ...:|:|.::...:||:|:||||.|...:.| |..:|:|.:.||.|  ...:||||
Zfish     4 KEINCTWKKSTNNIKEIFDFKEVLGSGSFSEVYLVRERKS-GNFYALKCVKKKQL--HHSNLENE 65

  Fly    79 IRVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEK 143
            |:||:               |:.|.|:|.|.:.||.::..|||||||:||||||||:::|.||||
Zfish    66 IQVLK---------------RIKHSNVVGLEDFYESRTHYYLVMELVSGGELFDRILDRGVYTEK 115

  Fly   144 DASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDSGIMATACGTP 208
            |||.:|.|:||||.|:|:..:||||||||||||||||:::||||||||||||.|.|:|:||||||
Zfish   116 DASRVINQVLEAVSYLHQNSIVHRDLKPENLLYYSPDENAKIMISDFGLSKMSDHGVMSTACGTP 180

  Fly   209 GYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISE 273
            |||||||||||||.||||.||||||:||||.||||||:||:..||::|:|.::.|.|||||:|||
Zfish   181 GYVAPEVLAQKPYSKAVDCWSIGVITYILLSGYPPFYEENETRLFSKIMKAEYAFHSPYWDDISE 245

  Fly   274 SAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKNFAKSRWKQAYYAATV 338
            |||.||::::.....||||.:|||.|.||.|:.|.:.||..:|.||::||||||:||:|..|:..
Zfish   246 SAKDFIRHMLEKNPSKRYTTEQALSHPWIIGDTAHNDNIIHSVCEQIQKNFAKSKWKRAINASVA 310

  Fly   339 IRQMQRM 345
            :..|:|:
Zfish   311 VSHMRRL 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 160/273 (59%)
S_TKc 31..302 CDD:214567 158/270 (59%)
camk1gaNP_956260.1 STKc_CaMKI_gamma 17..300 CDD:271068 174/300 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 318 1.000 Domainoid score I1229
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 426 1.000 Inparanoid score I1728
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 1 1.000 - - FOG0000163
OrthoInspector 1 1.000 - - otm25043
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24347
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X46
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.930

Return to query results.
Submit another query.