DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and stk17a

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001082806.1 Gene:stk17a / 327345 ZFINID:ZDB-GENE-030131-5556 Length:367 Species:Danio rerio


Alignment Length:299 Identity:108/299 - (36%)
Similarity:159/299 - (53%) Gaps:26/299 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LKELNKQVSIE---EKYN-LHGL-LGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKEESLE- 76
            |:|:...:..|   |:|: :.|. ||.|.|:.||....|.| |:.||.|.: :|..||::...| 
Zfish    27 LREIRTAIRSEPFTERYDVIPGKELGRGKFAVVRKCVEKSS-GKEFAAKYM-RKRRKGQDCRTEI 89

  Fly    77 -NEIRVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIV--EKG 138
             :||.||...:|      |        |.:|.|.|.||..|::.||:|...|||:|::.|  ...
Zfish    90 IHEIAVLELAAA------C--------PRVVNLHEVYEMPSEMVLVLEYAAGGEIFNQCVADRDE 140

  Fly   139 SYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSK-MEDSGIMA 202
            ::||::...|::||||.|.::|...|||.||||:|:|..|......|.|.|||||: :.:|..:.
Zfish   141 AFTEQEVKRLMKQILEGVSFLHNNNVVHLDLKPQNILLTSESPLGDIKIVDFGLSRLLSNSHEVR 205

  Fly   203 TACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPY 267
            ...|||.|||||||..:|...|.|:|||||:.|::|.|..||..::....|..|.:.:..:....
Zfish   206 EIMGTPEYVAPEVLNYEPISTATDMWSIGVLVYVMLTGISPFLGDDKQETFLNISQINISYSEEE 270

  Fly   268 WDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNE 306
            .:.:..||..|||:|:....|.|.|.:..|.|.|:...|
Zfish   271 LEHLDGSAIRFIKSLLIKEPENRATAEDCLKHQWLQTEE 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 104/283 (37%)
S_TKc 31..302 CDD:214567 102/277 (37%)
stk17aNP_001082806.1 PKc_like 35..305 CDD:304357 104/285 (36%)
S_TKc 48..305 CDD:214567 101/272 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.