DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and Phkg1

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_113761.1 Gene:Phkg1 / 29353 RGDID:3325 Length:388 Species:Rattus norvegicus


Alignment Length:286 Identity:103/286 - (36%)
Similarity:155/286 - (54%) Gaps:33/286 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIID--------KKALKGKEESLENEIRVLRRF 85
            |.|....:||.|..|.||....|.:..| :||||||        .:.::...|:...|:.:|::.
  Rat    18 ENYEPKEILGRGVSSVVRRCIHKPTCQE-YAVKIIDITGGGSFSSEEVQELREATLKEVDILQKV 81

  Fly    86 SANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIR 150
            |.              ||||:||.:|||..:..:||.:|:..|||||.:.||.:.|||:...::|
  Rat    82 SG--------------HPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKVTLTEKETRKIMR 132

  Fly   151 QILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLS-KMEDSGIMATACGTPGYVAPE 214
            .:||.|..:|:..:|||||||||:|.   ||:..|.::|||.| :::....:...||||.|:|||
  Rat   133 ALLEVVCTLHKLNIVHRDLKPENILL---DDNMNIKLTDFGFSCQLQPGEKLREVCGTPSYLAPE 194

  Fly   215 VL------AQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISE 273
            ::      ....|||.||:||.|||.|.||.|.|||:......:...|:.|.::|.||.||:.|:
  Rat   195 IIQCSMDEGHPGYGKEVDMWSTGVIMYTLLAGSPPFWHRKQMLMLRMIMDGKYQFGSPEWDDYSD 259

  Fly   274 SAKHFIKNLMCVTVEKRYTCKQALGH 299
            :.|..:...:.|..:.|.:.::||.|
  Rat   260 TVKDLVSRFLVVQPQDRCSAEEALAH 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 103/286 (36%)
S_TKc 31..302 CDD:214567 102/284 (36%)
Phkg1NP_113761.1 PKc_like 16..291 CDD:419665 103/286 (36%)
Calmodulin-binding (domain-N) 303..327
Calmodulin-binding (domain-C) 343..367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.