DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and srk1

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_588136.1 Gene:srk1 / 2539027 PomBaseID:SPCC1322.08 Length:580 Species:Schizosaccharomyces pombe


Alignment Length:494 Identity:147/494 - (29%)
Similarity:219/494 - (44%) Gaps:127/494 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KKDSGKKAKAKDLKELNKQVSIE-------------EKYNLHGLLGTGAFSEVRLAESKDSPGEH 57
            |:.:.:|...|.::.|..:..:|             |:|.|...:|.||||.|..| ..:..||.
pombe    86 KQPTNEKEYDKAIEALVAKAIVEEHSGQQFPVYKGLEQYTLLQKMGDGAFSNVYKA-IHNRTGEK 149

  Fly    58 FAVKII----------DKKALKGKE-ESLENEIRVLRRFSANHFDGKCLNGTRLTHPNIVQLLET 111
            .|:|::          |.:..:|.| .::..|::::|               |:.||||:||||.
pombe   150 VAIKVVQRAQPNTDPRDPRKRQGVESHNILKEVQIMR---------------RVKHPNIIQLLEF 199

  Fly   112 YEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQ-GVVHRDLKPENLL 175
            .:.....|||:||..|||||.:||....::|..:.|:|.|:..|:.|:||. ||||||:||||||
pombe   200 IQTPEYYYLVLELADGGELFHQIVRLTYFSEDLSRHVITQVAHAIRYLHEDCGVVHRDIKPENLL 264

  Fly   176 Y------------YSPDDD------------------SKIMISDFGLSKMEDSGIMATACGTPGY 210
            :            |...||                  .:|.::||||||:.......|.|||.||
pombe   265 FDSIDFVPSRVRKYRAGDDPDKVDEGEFIPGVGAGTIGRIRLADFGLSKVVWDSHTQTPCGTMGY 329

  Fly   211 VAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESA 275
            .|||::..:.|.|.||:|::|.:.|.:|||:||||||:.:.|..::.:|::.|.||:||:||:||
pombe   330 TAPEIVRDERYSKGVDMWALGCVLYTILCGFPPFYDESISLLTKKVSRGEYSFLSPWWDDISKSA 394

  Fly   276 KHFIKNLMCVTVEKRYTCKQALGHAWISG------------NEASSRN----------------- 311
            |..|.:|:.|..|.||...|.|.|.||||            |.|...|                 
pombe   395 KDLISHLLTVDPESRYDIHQFLAHPWISGSREPTFPATDAPNTAQRENPFTYDFLEPEDVAAAGS 459

  Fly   312 -------------------IHGTVSEQLKKNFAKSRWKQAYYAATVIRQMQRMALNSNSNANFDS 357
                               .|....|:::|.  ..|..|.     ::..|..|......|.::|.
pombe   460 AARTPGVNSLREVFNISYAAHRMEQEKIRKR--GQRGNQG-----IMNFMGDMDDLMEENDDYDD 517

  Fly   358 SNSSNQDSTTPTAATGAWTSNVLSSQQSVQSHAQEMNKS 396
            ...|.:.|......:|. ....|:|:|..||..|...:|
pombe   518 GTKSVEHSMKRVNLSGE-NDPSLASRQPAQSQQQSSQRS 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 117/328 (36%)
S_TKc 31..302 CDD:214567 115/312 (37%)
srk1NP_588136.1 STKc_RCK1-like 122..421 CDD:270998 116/314 (37%)
S_TKc 124..421 CDD:214567 115/312 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.