DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and Uhmk1

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_058989.1 Gene:Uhmk1 / 246332 RGDID:2968 Length:419 Species:Rattus norvegicus


Alignment Length:232 Identity:59/232 - (25%)
Similarity:94/232 - (40%) Gaps:38/232 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YNLHGLLGTGAFSEVRLAESKDSPG------EHFAVKIIDKKALKGKEESLENEIRVLRRFSANH 89
            :.:...||:|:.:.|.......:||      :.|........|....|.....|...|.:.. .|
  Rat    23 WQVQSRLGSGSSASVYRVRCCGTPGSPPGALKQFLPPGTTGAAASAAEYGFRKERAALEQLQ-GH 86

  Fly    90 FDGKCLNGTRLTH--PNIVQ---LLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLI 149
            .:...|.|....|  ||:..   |||..:......||.....|..::  :::          |..
  Rat    87 RNIVTLYGVFTIHFSPNVPSRCLLLELLDVSVSELLVYSSHQGCSMW--MIQ----------HCA 139

  Fly   150 RQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDSGIMATACGTPGYVAPE 214
            |.:|||:.::|.:|.||.||||.|:|:.:.::..|::  ||||| .::.........|.||.|||
  Rat   140 RDVLEALAFLHHEGYVHADLKPRNILWSAENECFKLI--DFGLS-FKEGNQDVKYIQTDGYRAPE 201

  Fly   215 VLAQKPYGK-----------AVDVWSIGVISYILLCG 240
            ...|....:           |||:||:|:|...:..|
  Rat   202 AELQNCLAQAGLQSDTECTSAVDLWSLGIILLEMFSG 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 59/232 (25%)
S_TKc 31..302 CDD:214567 59/232 (25%)
Uhmk1NP_058989.1 STKc_KIS 22..308 CDD:270922 59/232 (25%)
RRM_UHMK1 318..405 CDD:409898
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.