DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and Pskh1

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_775608.1 Gene:Pskh1 / 244631 MGIID:3528383 Length:424 Species:Mus musculus


Alignment Length:331 Identity:146/331 - (44%)
Similarity:209/331 - (63%) Gaps:28/331 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKEESLENEIRVLRRFSANHFD 91
            :..||::..|:|.|:||.|...|.: :..:.:|:|:|:.|..:|: |..|:|:||||        
Mouse    94 VTAKYDIKALIGRGSFSRVVRVEHR-ATRQPYAIKMIETKYREGR-EVCESELRVLR-------- 148

  Fly    92 GKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAV 156
                   |:.|.||:||:|.:|.:.:||:||||.|||||||||:.|||:||:||:.:::.:|:.|
Mouse   149 -------RVRHANIIQLVEVFETQERVYMVMELATGGELFDRIIAKGSFTERDATRVLQMVLDGV 206

  Fly   157 DYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLS---KMEDSGIMATACGTPGYVAPEVLAQ 218
            .|:|..|:.||||||||||||.|..||||:|:||||:   |..|..:|.|.||||.|:|||||.:
Mouse   207 RYLHALGITHRDLKPENLLYYHPGTDSKIIITDFGLASARKKGDDCLMKTTCGTPEYIAPEVLVR 271

  Fly   219 KPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLM 283
            |||..:||:|::|||:||||.|..||.|:|...|:.|||:|.:.:....|..:|..||.||..|:
Mouse   272 KPYTNSVDMWALGVIAYILLSGTMPFEDDNRTRLYRQILRGKYSYLGEPWPSVSNLAKDFIDRLL 336

  Fly   284 CVTVEKRYTCKQALGHAWISGNEASS--RNIHGTVSEQLKKNFAKSRWKQAYYAATVIRQMQRMA 346
            .|....|.|..|||.|.|:....|||  :|:|.::|:.|.|. |.||.:     :|...|..|.:
Mouse   337 TVDPGARMTALQALRHPWVVSMAASSSMKNLHRSISQNLLKR-ASSRCQ-----STKSSQSTRSS 395

  Fly   347 LNSNSN 352
            .::.||
Mouse   396 RSTRSN 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 129/276 (47%)
S_TKc 31..302 CDD:214567 128/273 (47%)
Pskh1NP_775608.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..79
STKc_PSKH1 96..355 CDD:270989 129/275 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 378..408 8/30 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 1 1.000 - - FOG0000163
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X46
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.