DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and mlck-1

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_509689.1 Gene:mlck-1 / 181217 WormBaseID:WBGene00013869 Length:1211 Species:Caenorhabditis elegans


Alignment Length:430 Identity:124/430 - (28%)
Similarity:202/430 - (46%) Gaps:63/430 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KDLKELNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKEESLENEIR 80
            |.::.:...|..:..|.:..|||.|.|.:|.....|:: |:.||.|.| |...:.....:|.|:.
 Worm    30 KKIENIRANVKFDTLYQVTKLLGDGKFGKVYCVIEKET-GKEFAAKFI-KIRKEADRAEVEREVS 92

  Fly    81 VLRRFSANHFDGKCLNGTRLTHPNIVQLLET-YEDKSKVYLVMELVTGGELFDRIVEKGSY--TE 142
            :|               |:|.||.|.|:.:. |...:.|.|:||:|.|||||||:.|: ||  :|
 Worm    93 IL---------------TQLRHPRIAQIYDAFYTTTNDVVLIMEIVRGGELFDRVAEE-SYVLSE 141

  Fly   143 KDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMED-SGIMATACG 206
            .....:|.|:.||:||:|:|.::|.|:||||::..|. ..::|.:.||||::..| :..:....|
 Worm   142 LAVVMIICQLCEAIDYIHKQNILHLDVKPENIMCVSL-TGNRIKLIDFGLARHYDGTQELKYMAG 205

  Fly   207 TPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEI 271
            ||.:.||||:..:......|:||||||:||||.||.||..:|....:..:.||.:||...: |.:
 Worm   206 TPEFAAPEVIKFEKLDYHTDMWSIGVITYILLSGYSPFLGDNLGETYCNVEKGVWEFTEEF-DTV 269

  Fly   272 SESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSR---------NIHGTVSEQLKKNFAKS 327
            :|.||.|:..|:.....||....:.|.|.||:.:...:.         |.....::|:.:..|:.
 Worm   270 TEEAKDFVTKLLVYDQSKRMLPHECLQHPWIAKHRQKAACNTILEKPLNAPTLDNKQIMRYNARR 334

  Fly   328 RWKQAYYAATVIRQMQRM--ALNSNSNAN----FD---------SSNSSNQDSTT--PTAATGAW 375
            ::::.......:.:|.|:  :|.:..:||    ||         ....||...|.  |.:..|:.
 Worm   335 KFRRMIIYVKFLIEMNRLRNSLKTRMSANGHKFFDPLLKMAEKKEQKISNAIGTAGCPASGLGSL 399

  Fly   376 TSNVLSSQQ-------------SVQSHAQEMNKSGGSTNA 402
            ....:.||:             |.:...:|..|.....||
 Worm   400 VKMAVDSQKKNGDVPVTQDANMSTEPEKEEKKKKKKIANA 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 98/277 (35%)
S_TKc 31..302 CDD:214567 98/274 (36%)
mlck-1NP_509689.1 PKc_like 51..300 CDD:389743 96/268 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.