DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and Camk2g

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_008768708.1 Gene:Camk2g / 171140 RGDID:621802 Length:588 Species:Rattus norvegicus


Alignment Length:415 Identity:150/415 - (36%)
Similarity:213/415 - (51%) Gaps:58/415 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKE-ESLENEIRVLRRFSANHFDG 92
            :.|.|...||.||||.||....|.|..| :|.|||:.|.|..:: :.||.|.|:.|         
  Rat    12 DDYQLFEELGKGAFSVVRRCVKKTSTQE-YAAKIINTKKLSARDHQKLEREARICR--------- 66

  Fly    93 KCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVD 157
                  .|.|||||:|.::..::...|||.:||||||||:.||.:..|:|.||||.|.||||:|:
  Rat    67 ------LLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQILESVN 125

  Fly   158 YMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDSGIMAT---ACGTPGYVAPEVLAQK 219
            ::|:..:|||||||||||..|....:.:.::||||: :|..|....   ..|||||::||||.:.
  Rat   126 HIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLA-IEVQGEQQAWFGFAGTPGYLSPEVLRKD 189

  Fly   220 PYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMC 284
            ||||.||:|:.|||.||||.|||||:||:...|:.||..|.::|.||.||.::..||:.|..::.
  Rat   190 PYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLT 254

  Fly   285 VTVEKRYTCKQALGHAWISGNEA------------------SSRNIHGTV--SEQLKKNFAKSRW 329
            :...||.|..|||.|.|:.....                  :.|.:.|.:  :..:.:||:..|.
  Rat   255 INPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKLKGAILTTMLVSRNFSVGRQ 319

  Fly   330 KQ-----AYYAATVIRQMQRMALNSNSNANFDSSNSS----------NQDSTTPTAATGAWTSNV 379
            ..     |..||.:..|..:..||..|:.......||          |::|....|...|.....
  Rat   320 SSAPASPAASAAGLAGQAAKSLLNKKSDGGVKKRKSSSSVHLMPQSNNKNSLVSPAQEPAPLQTA 384

  Fly   380 LSSQQSVQSHAQEMNKSGGSTNAAS 404
            :..|.:|..:|.:..|  |||.:.:
  Rat   385 MEPQTTVVHNATDGIK--GSTESCN 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 124/275 (45%)
S_TKc 31..302 CDD:214567 124/274 (45%)
Camk2gXP_008768708.1 STKc_CaMKII 12..303 CDD:270988 126/307 (41%)
CaMKII_AD 456..583 CDD:285524
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X46
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.