DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and Stk17b

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_596883.1 Gene:Stk17b / 170904 RGDID:620457 Length:371 Species:Rattus norvegicus


Alignment Length:337 Identity:109/337 - (32%)
Similarity:167/337 - (49%) Gaps:49/337 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKEESLE--NEIRVLRRFSANHFDGKCLNGTR 99
            ||.|.|:.||...|| |.|:.:|.|.: ||..:|::...|  :||.||      .....|     
  Rat    39 LGRGKFAVVRQCISK-STGQEYAAKFL-KKRRRGQDCRAEILHEIAVL------ELARSC----- 90

  Fly   100 LTHPNIVQLLETYEDKSKVYLVMELVTGGELFD----RIVEKGSYTEKDASHLIRQILEAVDYMH 160
               |:::.|.|.||..:::.||:|...|||:|:    .:.|..|  |.|...||:||||.|.|:|
  Rat    91 ---PHVINLHEVYETATEIILVLEYAAGGEIFNLCLPELAEMVS--ENDVIRLIKQILEGVHYLH 150

  Fly   161 EQGVVHRDLKPENLLYYS--PDDDSKIMISDFGLS-KMEDSGIMATACGTPGYVAPEVLAQKPYG 222
            :..:||.||||:|:|..|  |..|.||:  |||:| |:.::..:....|||.|:|||:|...|..
  Rat   151 QNNIVHLDLKPQNILLSSIYPLGDIKIV--DFGMSRKIGNASELREIMGTPEYLAPEILNYDPIT 213

  Fly   223 KAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTV 287
            .|.|:|:||:|:|:||....||..|::...:..|.:.:.::....:..:|:.|..||::|:....
  Rat   214 TATDMWNIGIIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEEMFSSVSQLATDFIQSLLVKNP 278

  Fly   288 EKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKNFAKSRWKQAYYAATVIRQMQRMALNSNSN 352
            |||.|.:..|.|:|:...:..|.......||.                    .|.|.::|.|:.:
  Rat   279 EKRPTAESCLSHSWLQQWDFGSLFHPEETSES--------------------SQTQDLSLRSSED 323

  Fly   353 ANFDSSNSSNQD 364
            ....|.|.|..|
  Rat   324 KTPKSCNGSCGD 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 97/272 (36%)
S_TKc 31..302 CDD:214567 97/273 (36%)
Stk17bNP_596883.1 STKc_DRAK2 24..293 CDD:271100 97/273 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..345 10/48 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.