Sequence 1: | NP_524622.1 | Gene: | CaMKI / 43792 | FlyBaseID: | FBgn0016126 | Length: | 405 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_653316.3 | Gene: | EFHB / 151651 | HGNCID: | 26330 | Length: | 833 | Species: | Homo sapiens |
Alignment Length: | 253 | Identity: | 52/253 - (20%) |
---|---|---|---|
Similarity: | 81/253 - (32%) | Gaps: | 98/253 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 129 ELFDRIVEKGSYTEKDASHLIRQILEAVDYM----------HEQGVVHRDLK------------- 170
Fly 171 PENLLYYSPDDDSKIMISDFGLS------------------KMEDSGIMATA----------CGT 207
Fly 208 P----GYVAPEVLA---QKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDS 265
Fly 266 PYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKN 323 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CaMKI | NP_524622.1 | STKc_CaMKI | 27..301 | CDD:270985 | 45/229 (20%) |
S_TKc | 31..302 | CDD:214567 | 45/230 (20%) | ||
EFHB | NP_653316.3 | EF-hand_7 | 566..626 | CDD:290234 | 8/29 (28%) |
EFh | 566..626 | CDD:238008 | 8/29 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0032 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |