DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and EFHB

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_653316.3 Gene:EFHB / 151651 HGNCID:26330 Length:833 Species:Homo sapiens


Alignment Length:253 Identity:52/253 - (20%)
Similarity:81/253 - (32%) Gaps:98/253 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 ELFDRIVEKGSYTEKDASHLIRQILEAVDYM----------HEQGVVHRDLK------------- 170
            :|||       |.:.|....| ..||..:::          :|:.|:.:..|             
Human   604 QLFD-------YCDVDNDGFI-NYLEFANFLNWKDKMLLKEYEERVIIKGRKPDCVNPTEANVEE 660

  Fly   171 PENLLYYSPDDDSKIMISDFGLS------------------KMEDSGIMATA----------CGT 207
            ||..|...|:|   |::.:.|.:                  |...|.|.|..          ||.
Human   661 PEQTLLIKPED---IVLKEAGSTEKTLRTLLRPSDKVSNYYKTTSSEINAIVGAIPSTCYPICGV 722

  Fly   208 P----GYVAPEVLA---QKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDS 265
            |    ...||.:..   :..||:...       :|.||  ||        .:||:  ||.||.|.
Human   723 PTIRSDIPAPRIRRISDRTNYGEEGS-------AYSLL--YP--------TIFAR--KGVFERDF 768

  Fly   266 PYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKN 323
                 ....:|..|..::|....|  ...:...:.|   |.||.::..|.|..:..:|
Human   769 -----FKTRSKEEIAEILCNIGVK--LSDEEFENVW---NLASKKHHRGEVCVENIRN 816

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 45/229 (20%)
S_TKc 31..302 CDD:214567 45/230 (20%)
EFHBNP_653316.3 EF-hand_7 566..626 CDD:290234 8/29 (28%)
EFh 566..626 CDD:238008 8/29 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.