DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and PNCK

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001034671.3 Gene:PNCK / 139728 HGNCID:13415 Length:426 Species:Homo sapiens


Alignment Length:332 Identity:195/332 - (58%)
Similarity:250/332 - (75%) Gaps:19/332 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KDLKELNKQV-SIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHF-AVKIIDKKALKGKEESLENE 78
            :|:..|.|.. .|...|.:...||:||||||.||:.:.|  .|. |:|.|.||||:|||..:|||
Human    82 QDMLLLKKHTEDISSVYEIRERLGSGAFSEVVLAQERGS--AHLVALKCIPKKALRGKEALVENE 144

  Fly    79 IRVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEK 143
            |.||||.|               |||||.|.:.:|..|.:||.|||||||||||||:|:||||||
Human   145 IAVLRRIS---------------HPNIVALEDVHESPSHLYLAMELVTGGELFDRIMERGSYTEK 194

  Fly   144 DASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDSGIMATACGTP 208
            |||||:.|:|.||.|:|..|:||||||||||||.:|.:|||||:|||||||::...::.||||||
Human   195 DASHLVGQVLGAVSYLHSLGIVHRDLKPENLLYATPFEDSKIMVSDFGLSKIQAGNMLGTACGTP 259

  Fly   209 GYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISE 273
            ||||||:|.|||||||||||::|||||||||||||||||:|..||:|||:..:|||||:||:|||
Human   260 GYVAPELLEQKPYGKAVDVWALGVISYILLCGYPPFYDESDPELFSQILRASYEFDSPFWDDISE 324

  Fly   274 SAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKNFAKSRWKQAYYAATV 338
            |||.||::|:....:||:||:|||.|.||||:.|..|:|.|:||||::||||::.||:|:.|.:.
Human   325 SAKDFIRHLLERDPQKRFTCQQALRHLWISGDTAFDRDILGSVSEQIRKNFARTHWKRAFNATSF 389

  Fly   339 IRQMQRM 345
            :|.::::
Human   390 LRHIRKL 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 171/274 (62%)
S_TKc 31..302 CDD:214567 170/271 (63%)
PNCKNP_001034671.3 STKc_CaMKI_beta 94..370 CDD:271071 181/292 (62%)
S_TKc 98..353 CDD:214567 170/271 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 319 1.000 Domainoid score I1246
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 425 1.000 Inparanoid score I1762
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 1 1.000 - - FOG0000163
OrthoInspector 1 1.000 - - otm40739
orthoMCL 1 0.900 - - OOG6_100153
Panther 1 1.100 - - O PTHR24347
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2171
SonicParanoid 1 1.000 - - X46
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.