DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and LOC100496389

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_002937423.1 Gene:LOC100496389 / 100496389 -ID:- Length:385 Species:Xenopus tropicalis


Alignment Length:378 Identity:157/378 - (41%)
Similarity:220/378 - (58%) Gaps:29/378 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKI---IDKKALKGKEESLENEIRVLRRFSAN 88
            :|..|.:...||.||.|.|...|.|.:...:.|.||   ||.|.::       .||.||      
 Frog    21 LENFYTIGQELGRGATSTVFKCEEKGTKKLYAAKKIKKTIDLKIVR-------TEIGVL------ 72

  Fly    89 HFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQIL 153
                     .||:||||::|.:.:|..:::.|::||||||||||||||:|.|:|:||:.:::|||
 Frog    73 ---------LRLSHPNIIKLKDIFETSAEITLILELVTGGELFDRIVERGYYSEQDAACVVQQIL 128

  Fly   154 EAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKM-EDSGIMATACGTPGYVAPEVLA 217
            |||.|:|..||||||||||||||.....||.:.|:||||||| :|...|.|.||||||.|||:|.
 Frog   129 EAVAYLHGNGVVHRDLKPENLLYADMTPDSILKIADFGLSKMIDDQVAMKTVCGTPGYCAPEILF 193

  Fly   218 QKPYGKAVDVWSIGVISYILLCGYPPFYD-ENDANLFAQILKGDFEFDSPYWDEISESAKHFIKN 281
            ..|||..||:||:|:|:||||||:.||:| ..|..::::||..||||.||:|||||.:||..:|.
 Frog   194 GSPYGPEVDMWSVGIITYILLCGFEPFFDPRGDQYMYSKILNCDFEFVSPWWDEISLNAKDLVKK 258

  Fly   282 LMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKNFAKSRWKQAYYAATVIRQMQRMA 346
            |:.:..:||.|..|||.|.|::|..|...::..|..:.|:.| |:.:.|.|..|.....::....
 Frog   259 LIVLDPKKRMTVSQALQHPWVTGKAAKLSHMDRTQKKLLEFN-ARRKLKAAVKAVVASSRLGNHG 322

  Fly   347 LNSNSNANFDSSNSSNQDSTTPTAATGAWTSNVLSSQQSVQSHAQEMNKSGGS 399
            .:.||. |..:..::....::...|:.:....|..|..:..|...|.|.|..|
 Frog   323 HHENSR-NLQTPENTRWSESSQEGASESCLPKVPGSVMAKASSTTEQNVSSES 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 136/278 (49%)
S_TKc 31..302 CDD:214567 135/275 (49%)
LOC100496389XP_002937423.1 PKc_like 21..314 CDD:389743 146/315 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.