DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and camk4

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_002943358.3 Gene:camk4 / 100490912 XenbaseID:XB-GENE-5911781 Length:388 Species:Xenopus tropicalis


Alignment Length:401 Identity:164/401 - (40%)
Similarity:233/401 - (58%) Gaps:54/401 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SGKKAKAKDLKELNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKI----IDKKALK 69
            ||..|....:...||. ::...|.|...||.||.|.|.....|.:. ..:|||:    :|||.::
 Frog    32 SGSAAPEYWIDGSNKD-TLAHYYELESELGRGATSVVYRCRQKGTQ-RPYAVKMLKKTVDKKIVR 94

  Fly    70 GKEESLENEIRVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRI 134
                   .||.||               .||:||||::|.|.:|..:::.||:||||||||||||
 Frog    95 -------TEIGVL---------------LRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRI 137

  Fly   135 VEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDSG 199
            ||||.|:|:||:..::||||||.|:||.|:||||||||||||.:|..|:.:.|:||||||:.|..
 Frog   138 VEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIADFGLSKIVDDQ 202

  Fly   200 I-MATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDE-NDANLFAQILKGDFE 262
            : |.|.||||||.|||:|....||..||:||:|:|:||||||:.||||| .|..:|.:||..|::
 Frog   203 VTMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQYMFKRILNCDYD 267

  Fly   263 FDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKNFAKS 327
            |.||:||::|.:||..:|.|:....:||.|.:|||.|.|::|..|:..:: ....::|::..|:.
 Frog   268 FVSPWWDDVSLNAKDLVKKLIVFDPKKRLTTQQALQHPWVTGKAANFAHM-DNAQKKLQEFNARR 331

  Fly   328 RWKQAYYAATVIRQMQRMALNSNSNANFDSSNSSNQDSTTPTAATGAWTSNVLSSQQSV--QSHA 390
            :.|.|..|.        :|.:...:|...||:.||:.|..|:..           |:||  ::..
 Frog   332 KLKAAVKAV--------VASSRLGSAGSHSSHDSNKPSRNPSPV-----------QESVCEETPT 377

  Fly   391 QEMN--KSGGS 399
            ||..  :.|||
 Frog   378 QETKQVEEGGS 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 135/279 (48%)
S_TKc 31..302 CDD:214567 135/276 (49%)
camk4XP_002943358.3 STKc_CaMKIV 49..342 CDD:270987 143/324 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 1 1.000 - - FOG0000163
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X46
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.