DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and dclk2

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_012811056.1 Gene:dclk2 / 100487296 XenbaseID:XB-GENE-960488 Length:727 Species:Xenopus tropicalis


Alignment Length:301 Identity:137/301 - (45%)
Similarity:193/301 - (64%) Gaps:21/301 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKEESLENEIRVLRRFSANHFD 91
            |.|||.:..::|.|.|:.|:....: |.|:.||:|||||....|||..:|||:.:||        
 Frog   394 ILEKYKIGKVIGDGNFAVVKECVER-STGKEFALKIIDKAKCCGKEHLIENEVSILR-------- 449

  Fly    92 GKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAV 156
                   ::.||||:.|:|..:..:::|||||||.||:|||.|.....|||:|||.::..:..|:
 Frog   450 -------QVKHPNIIMLIEEMDTTAELYLVMELVKGGDLFDAITSSTKYTERDASAMVYNLASAM 507

  Fly   157 DYMHEQGVVHRDLKPENLLYYS-PDDDSKIMISDFGLSKMEDSGIMATACGTPGYVAPEVLAQKP 220
            .|:|...:||||:||||||... ||....:.:.||||:.:.| |.:.|.||||.|||||::|:..
 Frog   508 KYLHGLHIVHRDIKPENLLVCEYPDKTKSLKLGDFGLATVVD-GPLYTVCGTPTYVAPEIIAETG 571

  Fly   221 YGKAVDVWSIGVISYILLCGYPPFYDEND--ANLFAQILKGDFEFDSPYWDEISESAKHFIKNLM 283
            ||..||:|:.|||:||||||:|||..||:  .:||.|||.|..||.|||||.|::|||..|..::
 Frog   572 YGLKVDIWAAGVITYILLCGFPPFRSENNLQEDLFDQILIGKLEFPSPYWDNITDSAKELISCML 636

  Fly   284 CVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKNF 324
            .|.||:|||.:|.|.|.|:| ::||..|:...|:.:||::|
 Frog   637 QVNVEERYTAEQILSHPWVS-DDASQGNMQVEVTGKLKQHF 676

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 128/276 (46%)
S_TKc 31..302 CDD:214567 125/273 (46%)
dclk2XP_012811056.1 DCX1_DCLK2 70..154 CDD:340661
DCX2 193..276 CDD:340589
STKc_DCKL2 396..654 CDD:271086 127/274 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.