DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and XB22062963

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001135626.1 Gene:XB22062963 / 100216185 XenbaseID:XB-GENE-22062964 Length:385 Species:Xenopus tropicalis


Alignment Length:370 Identity:150/370 - (40%)
Similarity:227/370 - (61%) Gaps:37/370 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 AKDLKELNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEH-FAVKIIDKKALKGKEESLENE 78
            |:..|..|....|.:||::..||....|.|:.||  ::.|.:. |..|...||..:....:.:||
 Frog     8 ARSDKSYNCFSDITDKYDIGELLCAKEFCEICLA--REIPTDRLFLCKKFLKKDGRKVRRAAKNE 70

  Fly    79 IRVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEK 143
            |.:|          |.:|     ||||:||::|:|.|.:.|::.||.|||::||.|..:|.|:|:
 Frog    71 ISIL----------KLVN-----HPNILQLIDTFETKKEFYIIQELATGGDVFDWISAQGYYSER 120

  Fly   144 DASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDSGIMATACGTP 208
            |||:::||:||||.|:|...:|||:||.|||:||:.::.||:::.||.||..| ||.:...||||
 Frog   121 DASNVLRQLLEAVSYLHSLRIVHRNLKLENLMYYNQNNHSKVVLRDFYLSCFE-SGEITEPCGTP 184

  Fly   209 GYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDEND--------ANLFAQILKGDFEFDS 265
            .|:||||:::..||:.||.|::||:.:|||.|.|||||||:        ..:|.:||.|::||||
 Frog   185 EYLAPEVVSRHRYGRPVDCWAVGVVMFILLSGNPPFYDENEEENSESHNRKIFRKILAGEYEFDS 249

  Fly   266 PYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKNFAKSRWK 330
            ||||.||.|||..:..||.:..|:|.|.:.||.|.|||||.||.||:...|..|::|||||::|:
 Frog   250 PYWDVISASAKDLVSRLMEMDQEQRITAQDALAHTWISGNAASERNLKEGVCAQIEKNFAKAKWR 314

  Fly   331 QAYYAATVIRQMQ-----RMALNSNSNANFDSSNSSNQDSTTPTA 370
            :|....|.:::::     |:.:...|     |.:.|::.:..|.:
 Frog   315 KAIRVTTFMQRLRAPEGARLPVTPRS-----SMSVSHEVTVAPAS 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 123/282 (44%)
S_TKc 31..302 CDD:214567 121/279 (43%)
XB22062963NP_001135626.1 PKc_like 22..286 CDD:304357 122/281 (43%)
S_TKc 24..286 CDD:214567 121/279 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 1 1.000 - - FOG0000163
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.