DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lgs and pygo1

DIOPT Version :9

Sequence 1:NP_651922.1 Gene:lgs / 43791 FlyBaseID:FBgn0039907 Length:1469 Species:Drosophila melanogaster
Sequence 2:NP_001107109.1 Gene:pygo1 / 797729 ZFINID:ZDB-GENE-080204-62 Length:337 Species:Danio rerio


Alignment Length:329 Identity:76/329 - (23%)
Similarity:114/329 - (34%) Gaps:103/329 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   814 GTGSLSGSV-PQANTSTVQAGTTTVLSANKNCFQADTPSPSNQNRSRNTGSSSVLTHNLSSNPST 877
            |.|.|.||. .:...|:.||...:.||.     .|..|:||             ..|.:::||..
Zfish    27 GPGLLLGSPDKKRRKSSTQAPPFSPLSE-----YAPPPNPS-------------ADHLIAANPFD 73

  Fly   878 PLSHLSPKEFESFGQS---SAGDNMKSRRPSPQG---QRSPVNSLIEANKDVRFAASSPGFNPHP 936
            . :::||.....||.|   ::.....||.|||.|   |..|          ..|:.:..||: ..
Zfish    74 D-NYISPSLKPYFGHSHYPASNSYGSSRMPSPYGPTIQTQP----------QYFSQNPTGFS-RT 126

  Fly   937 HMQSNSNSALNAYKMGSTNIQMERQASAQGGSVQFSRRSDNIP---LNPNSGNRPPPNKMTQNFD 998
            |..:.|.:.::|:..||.|     ..:...|||:   ..|.||   ||..|....|....|:|..
Zfish   127 HRFNYSPNYVHAFCGGSNN-----NNNMHFGSVE---HGDQIPLQNLNQRSPGFNPDANTTRNMS 183

  Fly   999 PISSLAQMSQQLTSCVSSMGSPAGTGGMTMMGGPGPSDINIEHGIISGLDGSGIDTINQNNCHSM 1063
            |  :|...:|                          |:...:|.          :..|:...|::
Zfish   184 P--NLNNFTQ--------------------------SNTKQDHS----------EAANKKYSHNV 210

  Fly  1064 NVVMNSMGPRMLNPKMCVAGGPNGPPG-FNPN----SPN---GGLRENSIGSGCGSANSSNFQGV 1120
            |...|:.....      ..|||....| |:.|    ||:   ..||.|.:..   .:.||:.:.|
Zfish   211 NCEENATQDNK------TKGGPEKLNGVFHSNNEKKSPDYRRSALRMNKVKR---RSTSSSSEPV 266

  Fly  1121 VPPG 1124
            .|.|
Zfish   267 FPCG 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lgsNP_651922.1 BCL9 521..559 CDD:288370
pygo1NP_001107109.1 PHD_PYGO1 267..323 CDD:277105 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23194
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.