DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lgs and Pygo1

DIOPT Version :9

Sequence 1:NP_651922.1 Gene:lgs / 43791 FlyBaseID:FBgn0039907 Length:1469 Species:Drosophila melanogaster
Sequence 2:NP_001178046.1 Gene:Pygo1 / 691857 RGDID:1594620 Length:417 Species:Rattus norvegicus


Alignment Length:404 Identity:90/404 - (22%)
Similarity:134/404 - (33%) Gaps:109/404 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1081 VAGGPNGPPGFNPNSPNGGLRENSIGSGCGSANSSNFQGVVPPGARMMGRMPVNFGSNFNPNI-Q 1144
            |.||.:|..|.  ..||     ..:||.......::.||...|........|       |||. .
  Rat    15 VRGGDSGLDGL--GGPN-----IQLGSPDKKKRKASTQGASFPPLSEYAPPP-------NPNADH 65

  Fly  1145 VKASTP-----NTIQYMPVRAQNANNNNN----NGANNVRMPPSLEFLQRYANPQMGAVGNGSPI 1200
            :.|:.|     |||.|.|:.:.|...:..    .|.:..||||       :..|:|     .||.
  Rat    66 LVAANPFDDSYNTISYKPLPSSNPYLSPGYPGFGGYSTFRMPP-------HVPPRM-----SSPY 118

  Fly  1201 CPPSASDGTP-GMPGLMAGPGAGGMLMNSSGEQHQNKITNNPGASNGI----------------- 1247
            |.|.|....| ..|....|.|.......:.| .|.|....||..:|.:                 
  Rat   119 CGPYALRNQPHPFPQNPLGMGFNRPHAFNFG-PHDNSNFGNPPYNNVLTQDINMPSQHFRQGSAE 182

  Fly  1248 NFF----QNCNQMSIVDEEGGL-PGHDGSMNIGQPSMIRGMRPHAMRPNVMGARMPPVNRQIQFA 1307
            ||.    ||..|:|..|..... ||::.:.|    |.:.........||..|....|:.:| .|.
  Rat   183 NFSQIPPQNVGQVSNPDLASNFAPGNNSNFN----SPLESNHSFIPPPNSFGQAKAPLPKQ-DFT 242

  Fly  1308 QSSDGIDCVGDPSSFFTNASCNSAGPHMFGSAQQANQPKTQHIKNIPSGMCQNQSGLAVAQGQIQ 1372
            |.          ::..||.:.::..||: ......||...: :||:      |::.:.....:  
  Rat   243 QG----------AAKTTNQNSSTHPPHL-NMEDPVNQSNVE-LKNV------NRNNVVQENSR-- 287

  Fly  1373 LHGQGHAQGQSLIGPTNNNLMSTAGSVSATNGVSGINFVGPSSTD------LKYAQQYHSFQQQL 1431
               .|.|:      ||||:...|........|.:.:     .:||      |..::..||....:
  Rat   288 ---SGSAE------PTNNHANGTQNKPRQPRGTADL-----CTTDKSRKFSLHPSRHGHSSSDPV 338

  Fly  1432 Y----ATNTRSQQQ 1441
            |    .||..:..|
  Rat   339 YPCGICTNEVNDDQ 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lgsNP_651922.1 BCL9 521..559 CDD:288370
Pygo1NP_001178046.1 PHD_PYGO1 339..395 CDD:277105 4/14 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23194
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.