DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lgs and PYGO1

DIOPT Version :9

Sequence 1:NP_651922.1 Gene:lgs / 43791 FlyBaseID:FBgn0039907 Length:1469 Species:Drosophila melanogaster
Sequence 2:NP_001317255.1 Gene:PYGO1 / 26108 HGNCID:30256 Length:419 Species:Homo sapiens


Alignment Length:501 Identity:108/501 - (21%)
Similarity:152/501 - (30%) Gaps:174/501 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   951 MGSTNIQM------ERQASAQGGSVQFSRRSDNI-PLNPNSGNRPPPNKMTQNFDPIS--SLAQM 1006
            :|...:|:      :|:|:.||.|  |...|:.. |.||||.:....|....|::.||  .|...
Human    25 LGGPGVQLGSPDKKKRKANTQGPS--FPPLSEYAPPPNPNSDHLVAANPFDDNYNTISYKPLPSS 87

  Fly  1007 SQQLTSCVSSMGSPAGTGGMT----------MMGGP--GPSDI-NIEHGIISGLDGSGIDTINQN 1058
            :..|     ..|.| |.||.:          .|..|  ||..: |..|.......|.|.     |
Human    88 NPYL-----GPGYP-GFGGYSTFRMPPHVPPRMSSPYCGPYSLRNQPHPFPQNPLGMGF-----N 141

  Fly  1059 NCHSMNVVMNSMGPR----MLNPKMCVAGGPNGPPGFNPNSPNGGLRENSIGSGCGSANSSNFQG 1119
            ..|:.|     .||.    ..||..      |.....|.|.||...|:|.         :.||..
Human   142 RPHAFN-----FGPHDNSSFGNPSY------NNALSQNVNMPNQHFRQNP---------AENFSQ 186

  Fly  1120 VVPPGARMMGRMPVNFGSNFNPNIQVKASTPNTIQYMPVRAQNANNNNNNGANNVRMPPSLEFLQ 1184
            :.|..|..:..  .:..|||.|                  ..|:|..:...:|:..:||...|.|
Human   187 IPPQNASQVSN--PDLASNFVP------------------GNNSNFTSPLESNHSFIPPPNTFGQ 231

  Fly  1185 RYANP-----QMGAVGN---GSPICPPSASDGTPGMPGLMAGPGAGGMLMNSSGEQHQNKI-TNN 1240
            ..|.|     ..||..|   .|...||.                     :|.....:|:.| ..|
Human   232 AKAPPPKQDFTQGATKNTNQNSSAHPPH---------------------LNMDDTVNQSNIELKN 275

  Fly  1241 PGASNGINFFQNCNQMSIVDEEGGLPGHDGSMNIGQPSMIRG---------MRPHAMRPNVMGAR 1296
            ...:|.:|  |..::.|..:.....|. :|:.|  :|...||         ....::.||..|  
Human   276 VNRNNAVN--QENSRSSSTEATNNNPA-NGTQN--KPRQPRGAADACTTEKSNKSSLHPNRHG-- 333

  Fly  1297 MPPVNRQIQFAQSSDGIDCVG--------DPSSFFTNASCNSAGPHMFGSAQQANQPKTQHIKNI 1353
                      ..|||.:...|        |..:....|||.                |..|  .|
Human   334 ----------HSSSDPVYPCGICTNEVNDDQDAILCEASCQ----------------KWFH--RI 370

  Fly  1354 PSGMCQNQSGLAVAQG-------------QIQLHGQGHAQGQSLIG 1386
            .:||.:...||..|:.             .:||.......|.|.:|
Human   371 CTGMTETAYGLLTAEASAVWGCDTCMADKDVQLMRTRETFGPSAVG 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lgsNP_651922.1 BCL9 521..559 CDD:288370
PYGO1NP_001317255.1 PHD_PYGO1 341..397 CDD:277105 13/73 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23194
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.