DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dati and CG3281

DIOPT Version :9

Sequence 1:NP_001245421.1 Gene:dati / 43789 FlyBaseID:FBgn0262636 Length:1150 Species:Drosophila melanogaster
Sequence 2:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster


Alignment Length:393 Identity:91/393 - (23%)
Similarity:147/393 - (37%) Gaps:98/393 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 PSTVSTDDAQSSAPSHQLAGTGRALQTHQCKPMSPGTVGSS-NLGAGRRSAPTTISKTFSQGQQS 341
            |...|.|.......|.||......::..:..  .|..:||. |..|..........:.|::.:..
  Fly   156 PLYASEDRDDEPEDSFQLKPRPDEIENRELS--RPSQLGSRLNHSANFIYKCAVCPRVFAKSESL 218

  Fly   342 PQHSTTPSGGSTTPDIKYNNDKMANEIQLQLSRSSSAAAISERTLEECWSTLQR---LFMH---- 399
            .:|.:  .....|.|:...  |:|||          :......|.|.|..|.:|   |..|    
  Fly   219 TRHFS--QAHKLTADVAAM--KLANE----------SCGTGLLTCEHCPRTFKRQDTLRRHMQAF 269

  Fly   400 --------------KSAMQQI--QQQIPRVGLGTHGVTGSANLGGSITPSSDTKPHQCQQCMKSF 448
                          .||.::|  ::..|..||.    ...::|...|...:...|::|.||.|:|
  Fly   270 HPDAIALEPEETTDNSARKRIAKRRDCPHCGLS----FPVSSLTIHIRRHTGDNPYKCDQCEKAF 330

  Fly   449 SSNHQLVQHIRVHTGEKPYKCSYCDRRFKQLSHVQQHTRLHTGERPYKCHLPDCGRAFIQLSNLQ 513
            ..:..|..|:|.||||:|.:|..|.::|...:.:.:|.|||||:|||.|.:  |.::|:|.::|:
  Fly   331 PRSQDLSLHMRQHTGERPSECKICSKKFISQNKLARHMRLHTGQRPYSCKM--CSKSFVQSNDLK 393

  Fly   514 QHLRNHDAQVERAKNRPFHCNICGKGFATESSLRTHTSK-----------ELQLHLGV------- 560
            .|:|.|..:      ||:.|.:||:.|...|.|..|.::           |::.:...       
  Fly   394 IHMRRHTGE------RPYQCGVCGESFVCGSHLNIHRNRKGHLIAVIPGNEVEANFAADPYVNAR 452

  Fly   561 ---------------------LQQHAALIGGPNATS----CPVCHKLFLGTEALVDH---MKHVH 597
                                 |||....:..|:..:    |.||.:.|.....|..|   |.|..
  Fly   453 VNQRRSEDIERMRLQRIPENQLQQRLENLPKPDVPAMCYKCGVCEQKFKSGALLTVHRNKMSHYE 517

  Fly   598 KEK 600
            .|:
  Fly   518 IER 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
datiNP_001245421.1 COG5048 <429..>511 CDD:227381 31/81 (38%)
C2H2 Zn finger 441..461 CDD:275368 8/19 (42%)
zf-H2C2_2 454..478 CDD:290200 11/23 (48%)
C2H2 Zn finger 469..489 CDD:275368 5/19 (26%)
zf-H2C2_2 481..508 CDD:290200 12/26 (46%)
C2H2 Zn finger 497..519 CDD:275368 7/21 (33%)
C2H2 Zn finger 533..557 CDD:275368 8/34 (24%)
C2H2 Zn finger 576..594 CDD:275368 6/20 (30%)
C2H2 Zn finger 667..687 CDD:275370
C2H2 Zn finger 702..719 CDD:275370
CG3281NP_650132.1 zf-AD 14..92 CDD:285071
C2H2 Zn finger 205..226 CDD:275368 2/22 (9%)
C2H2 Zn finger 249..266 CDD:275368 5/16 (31%)
COG5048 <294..>391 CDD:227381 35/102 (34%)
C2H2 Zn finger 296..315 CDD:275368 5/22 (23%)
zf-H2C2_2 307..330 CDD:290200 7/22 (32%)
C2H2 Zn finger 323..343 CDD:275368 8/19 (42%)
zf-H2C2_2 335..358 CDD:290200 10/22 (45%)
C2H2 Zn finger 351..371 CDD:275368 5/19 (26%)
zf-H2C2_2 364..388 CDD:290200 12/25 (48%)
C2H2 Zn finger 379..399 CDD:275368 7/21 (33%)
zf-H2C2_2 391..416 CDD:290200 10/30 (33%)
C2H2 Zn finger 407..424 CDD:275368 6/16 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.