DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dati and CG2678

DIOPT Version :9

Sequence 1:NP_001245421.1 Gene:dati / 43789 FlyBaseID:FBgn0262636 Length:1150 Species:Drosophila melanogaster
Sequence 2:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster


Alignment Length:434 Identity:89/434 - (20%)
Similarity:136/434 - (31%) Gaps:140/434 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   337 QGQQSPQHSTTPSGGSTTPDIKYNNDKMANEIQLQLSRSSSAAAISERTLEECWSTLQRLFMHKS 401
            |.:||.||.......|..|:         |::.|..........|:::            ...||
  Fly    77 QSEQSYQHFFRVLNQSGAPE---------NQVHLAACNGDKNQIINQK------------MQLKS 120

  Fly   402 AMQQIQQQIPRVGLGTHGVT---------GSANLGG--------------------SITPSSDTK 437
            ..||..||:.:.......::         ...|:.|                    .:.|...|:
  Fly   121 DRQQDTQQMTKTQKPDDDLSQKQTLQAKLQEGNIDGPPESFTLHPRKRTCRTEEQADMIPKEATR 185

  Fly   438 P----------HQCQQCMKSFSSNHQLVQHIRVHTGEKPYKCSYCDRRFKQLSHVQQHTRLHTGE 492
            .          :.|..|.|.|.|..||    |.|..:...:|.||.|.:.|.|::::|.|.|..:
  Fly   186 STKMICDADGYYNCPHCSKRFCSQTQL----RTHITDLCNRCPYCPRTYMQKSNLKRHLRNHLSK 246

  Fly   493 RPYKCHLPDCGRAFIQLSNLQQHLRNHDAQVERAKNRPFHCNICGKGFATESSLRTHTSKELQLH 557
            ..:||.  .|.:||::..:|::|||.||:      :.|..|:.|...|.....|..|..:     
  Fly   247 PAHKCF--HCSKAFMRKDHLKRHLRTHDS------DGPLSCSQCSAVFIEHVQLEIHRRE----- 298

  Fly   558 LGVLQQHAALIGGPNATSCPVCHKLFLGTEALVDHMKHVHKEKSPPPGGSASSQFSELNQIVTGN 622
                                  ||...|:.         ..|.:..|....|.|..:|....|.|
  Fly   299 ----------------------HKQRPGSS---------KSESTKDPDSDDSDQAQDLKPKWTKN 332

  Fly   623 G-NGTGS-----SNEQIATQCTTESNSHQATVGSSLIDSFLGKRRTANH-------PCPVCGKHY 674
            . |||.|     ..:.|...|..:.:|..|.           ||....|       .|..|.:.:
  Fly   333 TFNGTCSIPPMLKPKPICDICQKKFSSVYAL-----------KRHMLTHNRQHHLKKCTYCSEEF 386

  Fly   675 VNEGSLRKHLACHAENSQLTNSLRMWPCSVCQAVFTHENGLLTH 718
            ..|..|::|...|..:        ::.|..|..||...|.|..|
  Fly   387 KTEKHLKRHERGHMGD--------LFRCEFCSLVFVDVNYLRKH 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
datiNP_001245421.1 COG5048 <429..>511 CDD:227381 25/91 (27%)
C2H2 Zn finger 441..461 CDD:275368 8/19 (42%)
zf-H2C2_2 454..478 CDD:290200 7/23 (30%)
C2H2 Zn finger 469..489 CDD:275368 8/19 (42%)
zf-H2C2_2 481..508 CDD:290200 8/26 (31%)
C2H2 Zn finger 497..519 CDD:275368 8/21 (38%)
C2H2 Zn finger 533..557 CDD:275368 5/23 (22%)
C2H2 Zn finger 576..594 CDD:275368 3/17 (18%)
C2H2 Zn finger 667..687 CDD:275370 5/19 (26%)
C2H2 Zn finger 702..719 CDD:275370 7/17 (41%)
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 4/7 (57%)
COG5048 220..>284 CDD:227381 23/71 (32%)
C2H2 Zn finger 223..243 CDD:275368 8/19 (42%)
zf-C2H2 249..271 CDD:278523 9/23 (39%)
C2H2 Zn finger 251..271 CDD:275368 8/21 (38%)
C2H2 Zn finger 279..299 CDD:275368 5/46 (11%)
C2H2 Zn finger 350..370 CDD:275368 5/30 (17%)
C2H2 Zn finger 379..399 CDD:275368 5/19 (26%)
C2H2 Zn finger 406..427 CDD:275368 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.