DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dati and CG10654

DIOPT Version :9

Sequence 1:NP_001245421.1 Gene:dati / 43789 FlyBaseID:FBgn0262636 Length:1150 Species:Drosophila melanogaster
Sequence 2:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster


Alignment Length:274 Identity:60/274 - (21%)
Similarity:106/274 - (38%) Gaps:53/274 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 STTPSGGSTTPDIKYNND-------KMANEIQLQLSRSSSAAAISERTLEECWSTLQRLFMHKSA 402
            ||.|...|..|.|....:       ::...:.:.|||.:..|::.|.                  
  Fly   143 STNPEAQSHAPCIAATQEIVSFIWPQVCLPLAVILSRITLGASLEEE------------------ 189

  Fly   403 MQQIQQQIPRVGLGTHGVTGSANLGGSITPSSDTKPHQCQQCMKSFSSNHQLVQHIRVHTGEKPY 467
            :..|:.:..:..||...::.|:.|.|:..........:|:.|.:.|.....|..|::.|.|.:||
  Fly   190 VYVIEDESAKQDLGQEKLSISSKLLGARKRRGVRHTLECRICHRGFYKPSLLEAHMQQHEGLRPY 254

  Fly   468 KCSYCDRRFKQL----SHVQQ-HTRLHTGERPYKCHLPDCGRAFIQLSNLQQHLRN-----HDAQ 522
            .|.:|.:.:.:.    ||::| |.........|.|  |.|.:.:....:|:.|:|.     |:::
  Fly   255 TCVHCAKSYARANLLESHLRQMHNNADAARIIYAC--PSCNKVYTANRSLKYHMRRTHERYHESE 317

  Fly   523 VERAKNRPFHCNICGKGFATESSLRTHTSKELQLHLGVLQQHAALIGGPNATSCPVCHKLFLGTE 587
            ...|::   .|..|||.||.::.|..|.           ..|.::.|  ....|..|.:.|...|
  Fly   318 SPDARH---ICEECGKCFARKAHLTRHK-----------MVHGSVEG--RRYCCECCDRRFYTKE 366

  Fly   588 ALVDHMKHVHKEKS 601
            .:|||:...|..|:
  Fly   367 NMVDHLLRKHGNKN 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
datiNP_001245421.1 COG5048 <429..>511 CDD:227381 19/86 (22%)
C2H2 Zn finger 441..461 CDD:275368 5/19 (26%)
zf-H2C2_2 454..478 CDD:290200 8/23 (35%)
C2H2 Zn finger 469..489 CDD:275368 6/24 (25%)
zf-H2C2_2 481..508 CDD:290200 7/27 (26%)
C2H2 Zn finger 497..519 CDD:275368 6/26 (23%)
C2H2 Zn finger 533..557 CDD:275368 8/23 (35%)
C2H2 Zn finger 576..594 CDD:275368 7/17 (41%)
C2H2 Zn finger 667..687 CDD:275370
C2H2 Zn finger 702..719 CDD:275370
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071
C2H2 Zn finger 228..248 CDD:275368 5/19 (26%)
C2H2 Zn finger 256..313 CDD:275368 13/58 (22%)
C2H2 Zn finger 289..314 CDD:275368 6/26 (23%)
zf-C2H2 323..345 CDD:278523 8/35 (23%)
C2H2 Zn finger 325..345 CDD:275368 8/30 (27%)
C2H2 Zn finger 355..376 CDD:275368 7/20 (35%)
C2H2 Zn finger 385..405 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.