DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dati and wor

DIOPT Version :9

Sequence 1:NP_001245421.1 Gene:dati / 43789 FlyBaseID:FBgn0262636 Length:1150 Species:Drosophila melanogaster
Sequence 2:NP_476601.1 Gene:wor / 34906 FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster


Alignment Length:654 Identity:139/654 - (21%)
Similarity:221/654 - (33%) Gaps:188/654 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 DFWQQARAPFGLQTALHQYSSPP-----NQQPISHHALHHSVPQENEQLAGVQPEGPAAGSGVVG 120
            |..:.:|.|...:..:.:.|||.     ::.|:.......:||.|...:|..:|| |......:.
  Fly     2 DKLKYSRCPLKKRPIMVEESSPEDHLSHDEGPVDLSVASAAVPMEPHWMAKSEPE-PQPVPTELR 65

  Fly   121 NNSSMAISGTNSTVGSK--AESSHI----PQQHSEQQ--------SYGSDSFRGTQ-----SPQL 166
            .....|::.|...:..:  .|:..|    |...:.::        .||.......:     .|:.
  Fly    66 RRFDAAMNQTKEQLARRIWEETREIARAFPDVFTREEIAKSLARLGYGEFELPPEEEVMEPEPEP 130

  Fly   167 SSHHLLFNAAAAAAAAVHLKSTAMQNNLSPIGDQVQNNLRNYGQGSLNALCGIKPKQEM-DAKTP 230
            ..|..|.....|:...:..:.:          |:.|..||||....|.::...:...:| :.|..
  Fly   131 EQHLPLRYTRDASPTIIKAEPS----------DEEQFPLRNYNNNLLKSIAEYEDCMKMQNIKEE 185

  Fly   231 LQPLDECPHPLVQAQAQSQYGGDYYDVADPQAREISEGRALIIGLGAPSTVSTDDAQSSAPSHQL 295
            :.|:   |.|.:           :|....|              |..|..:|....:..:.:..|
  Fly   186 IPPI---PSPQL-----------FYPPPTP--------------LAEPEDLSVTQRRVLSENMNL 222

  Fly   296 AGTGRALQTHQCKPMSPGTVGSSNLGAGRRSAPTTISKTFSQGQQSPQHSTTP---SGGSTTPDI 357
            ....|||                                .|....:|||:..|   .......||
  Fly   223 QNVARAL--------------------------------LSMQHMAPQHAPPPIDMEEDQENQDI 255

  Fly   358 KYNNDKMANEIQLQLSRSSSAAAISERTLEECWSTLQRLFMHKS--AMQQIQQQIPRVGLGTHG- 419
            .....|.:|::..|..:.:           :|::|...|..|:.  |.:..:.:|.|...|..| 
  Fly   256 NQLKIKSSNDLYYQCQQCN-----------KCYATYAGLVKHQQTHAYESTEYKIIRSQPGGSGA 309

  Fly   420 --------------VTGSANLGGSITPSSDTKP-----HQCQQCMKSFSSNHQLVQHIRVHTG-- 463
                          :..:||:..:   .|..||     :.||.|.||:|:...|.:|.:.|..  
  Fly   310 IVDQTEFCTDQASALIQAANVASA---QSMQKPVGVPRYHCQDCGKSYSTYSGLSKHQQFHCPSA 371

  Fly   464 -----EKPYKCSYCDRRFKQLSHVQQHTRLHTGERPYKCHLPDCGRAFIQLSNLQQHLRNHDAQV 523
                 :|.:.|..||:.:..|..::.|.|.||  .|.||  |.||:||.:...||.|:|.|..: 
  Fly   372 EGNQVKKVFSCKNCDKTYVSLGALKMHIRTHT--LPCKC--PICGKAFSRPWLLQGHIRTHTGE- 431

  Fly   524 ERAKNRPFHCNICGKGFATESSLRTHTSKELQLHLGVLQQHAALIGGPNATSCPVCHKLFLGTEA 588
                 :||.|..|.:.||..|:||.|    :|.|..|.:.           |||.|.|.|.....
  Fly   432 -----KPFSCQHCNRAFADRSNLRAH----MQTHSDVKKY-----------SCPTCTKSFSRMSL 476

  Fly   589 LVDHMKH-VHKEKSPPPGGSASSQFSELNQIVTGNGNGTGSSNEQIATQCTTES-NSHQ----AT 647
            |..|::. ...|:|..|.||               |.|......|...|...|. |.||    .:
  Fly   477 LAKHLQSGCQTEQSGGPSGS---------------GGGFDQQQLQQHLQVYEEGHNPHQLYYAGS 526

  Fly   648 VGSS 651
            ||||
  Fly   527 VGSS 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
datiNP_001245421.1 COG5048 <429..>511 CDD:227381 29/93 (31%)
C2H2 Zn finger 441..461 CDD:275368 8/19 (42%)
zf-H2C2_2 454..478 CDD:290200 7/30 (23%)
C2H2 Zn finger 469..489 CDD:275368 6/19 (32%)
zf-H2C2_2 481..508 CDD:290200 12/26 (46%)
C2H2 Zn finger 497..519 CDD:275368 10/21 (48%)
C2H2 Zn finger 533..557 CDD:275368 9/23 (39%)
C2H2 Zn finger 576..594 CDD:275368 7/17 (41%)
C2H2 Zn finger 667..687 CDD:275370
C2H2 Zn finger 702..719 CDD:275370
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368 4/30 (13%)
C2H2 Zn finger 317..334 CDD:275368 2/19 (11%)
zf-C2H2 345..367 CDD:278523 8/21 (38%)
C2H2 Zn finger 347..367 CDD:275368 8/19 (42%)
PHA00732 379..>417 CDD:177300 16/41 (39%)
C2H2 Zn finger 382..402 CDD:275368 6/19 (32%)
zf-C2H2_8 405..482 CDD:292531 34/99 (34%)
zf-C2H2 406..428 CDD:278523 11/23 (48%)
C2H2 Zn finger 408..428 CDD:275368 10/21 (48%)
zf-H2C2_2 421..444 CDD:290200 9/28 (32%)
zf-C2H2 434..456 CDD:278523 10/25 (40%)
C2H2 Zn finger 436..456 CDD:275368 9/23 (39%)
zf-H2C2_2 448..473 CDD:290200 12/39 (31%)
C2H2 Zn finger 464..481 CDD:275368 6/16 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.