DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dati and Plzf

DIOPT Version :9

Sequence 1:NP_001245421.1 Gene:dati / 43789 FlyBaseID:FBgn0262636 Length:1150 Species:Drosophila melanogaster
Sequence 2:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster


Alignment Length:172 Identity:49/172 - (28%)
Similarity:73/172 - (42%) Gaps:29/172 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   433 SSDTKPHQCQQCMKSFSSNHQLVQHIRVHTGEKPYKCSYCDRRFKQLSHVQQHTRLHTGERPYKC 497
            |::| ||.|..|.|.|.....|..||.||..||...|..|......:..::.|..|||||. :.|
  Fly   265 STET-PHICPHCGKGFKWKQGLSNHILVHNPEKQMLCDVCGYSTTHMKALKSHKLLHTGEF-FAC 327

  Fly   498 HLPDCGRAFIQLSNLQQHLRNHDAQVERAKNRPFHCNICGKGFATESSLRTHTSKELQLHLGVLQ 562
            .:..|.....:..||:.|:..|      .:.|.|.|.:||..|:...:|:.|..|..:       
  Fly   328 TVSGCKHRANRKENLKLHIETH------KQGRDFICEVCGCKFSQSKNLKRHALKHTE------- 379

  Fly   563 QHAALIGGPNATSCPVC----HKLFLGTEALVDHMKHVHKEK 600
                  .|||...|.:|    |:    ::.:.:|::.||.||
  Fly   380 ------NGPNRYKCQLCGFSSHR----SDKMKEHVQRVHTEK 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
datiNP_001245421.1 COG5048 <429..>511 CDD:227381 25/77 (32%)
C2H2 Zn finger 441..461 CDD:275368 7/19 (37%)
zf-H2C2_2 454..478 CDD:290200 9/23 (39%)
C2H2 Zn finger 469..489 CDD:275368 3/19 (16%)
zf-H2C2_2 481..508 CDD:290200 8/26 (31%)
C2H2 Zn finger 497..519 CDD:275368 5/21 (24%)
C2H2 Zn finger 533..557 CDD:275368 7/23 (30%)
C2H2 Zn finger 576..594 CDD:275368 4/21 (19%)
C2H2 Zn finger 667..687 CDD:275370
C2H2 Zn finger 702..719 CDD:275370
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 44/162 (27%)
C2H2 Zn finger 214..234 CDD:275368
C2H2 Zn finger 244..264 CDD:275368
C2H2 Zn finger 272..292 CDD:275368 7/19 (37%)
C2H2 Zn finger 300..320 CDD:275368 3/19 (16%)
C2H2 Zn finger 330..349 CDD:275368 4/18 (22%)
C2H2 Zn finger 357..377 CDD:275368 6/19 (32%)
C2H2 Zn finger 387..408 CDD:275368 4/24 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.