DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dati and CG9609

DIOPT Version :9

Sequence 1:NP_001245421.1 Gene:dati / 43789 FlyBaseID:FBgn0262636 Length:1150 Species:Drosophila melanogaster
Sequence 2:NP_573161.1 Gene:CG9609 / 32663 FlyBaseID:FBgn0030787 Length:403 Species:Drosophila melanogaster


Alignment Length:458 Identity:95/458 - (20%)
Similarity:157/458 - (34%) Gaps:136/458 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   400 KSAMQQIQQQIPRVGLGTHGVTGSANLGGSITPSSDTKPHQCQQCMKSFSSNHQLVQHIRVHTGE 464
            ::|:::.:|:     .|.....|||....|:           .:|..:|....||.:|...|||.
  Fly    14 ETALEEFKQR-----QGRRNSIGSAKYACSM-----------PKCEATFKRLDQLDRHEYHHTGI 62

  Fly   465 KPYKCSY--CDRRFKQLSHVQQHTRLHTGERP-------YKCHLPDCGRAFIQLSNLQQHLR-NH 519
            |.:.|||  ||:.:..::|:::|.| .|.|||       .||.|.:|.:.||.:||:.:|:| .|
  Fly    63 KKHACSYEGCDKTYSIVTHLKRHLR-STHERPESAAKKTVKCALEECSKMFISVSNMTRHMRETH 126

  Fly   520 DAQVERAKNRPFHCNICGKGFATESSLRTHTSKELQLHL---------GVLQQHAALIGGPNAT- 574
            ::.      :.:.|:.|...|:.:..|:.|..:|..|..         |..||.......|:.. 
  Fly   127 ESP------KVYPCSQCSAKFSQKLKLKRHEIREHTLEYPYSCSKCSRGFYQQWQCQSHEPSCKL 185

  Fly   575 -SCPVCHKLFLGTEALVDHMKHVHKEKSPPPGGSASSQFSELNQIVTGNGNGTGSSNEQIATQCT 638
             .||.|...|   :....:.||..                                         
  Fly   186 YECPGCPLQF---DKWTLYTKHCR----------------------------------------- 206

  Fly   639 TESNSHQATVGSSLIDSFLGKRRTANHPCPVCGKHYVNEGSLRKHLAC-HAENSQLTNSLRMWPC 702
                           ||..||.|   |.|..|...:.....|::||.. |.|.:|.......:.|
  Fly   207 ---------------DSLHGKNR---HKCDRCDSAFDKPSELKRHLEVKHKEAAQTDECATSFTC 253

  Fly   703 SV--CQAVFTHENGLLTHM---------ESMRMDPKHQFAAQYVLSRAAAEQRERESLLAVTLAA 756
            :.  |...:::...|..||         |...:|....|::...|:|......:           
  Fly   254 NEEGCGKSYSYLRNLRQHMLTAHSGRRFECQALDCGRCFSSAQNLARHLLRDHK----------- 307

  Fly   757 SSGASTRIGIADAGNVLPTGAHNSDGSNSKCPSPSANSEC--SSNGRLSSSTTSDQDQDIDHGLS 819
             .||:.:...|...:...||    :|..:|..|.....:.  |.:.|||.......|::.|..:.
  Fly   308 -DGATKKELKAKKKDKSKTG----EGGKTKSTSRKRRRDAGRSKHSRLSKLACLQLDKEDDEAVR 367

  Fly   820 ENE 822
            |.:
  Fly   368 ERQ 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
datiNP_001245421.1 COG5048 <429..>511 CDD:227381 28/90 (31%)
C2H2 Zn finger 441..461 CDD:275368 5/19 (26%)
zf-H2C2_2 454..478 CDD:290200 11/25 (44%)
C2H2 Zn finger 469..489 CDD:275368 8/21 (38%)
zf-H2C2_2 481..508 CDD:290200 12/33 (36%)
C2H2 Zn finger 497..519 CDD:275368 9/22 (41%)
C2H2 Zn finger 533..557 CDD:275368 6/23 (26%)
C2H2 Zn finger 576..594 CDD:275368 4/17 (24%)
C2H2 Zn finger 667..687 CDD:275370 5/20 (25%)
C2H2 Zn finger 702..719 CDD:275370 3/18 (17%)
CG9609NP_573161.1 C2H2 Zn finger 40..59 CDD:275368 5/18 (28%)
zf-C2H2_8 67..150 CDD:292531 27/89 (30%)
C2H2 Zn finger 67..90 CDD:275368 8/23 (35%)
C2H2 Zn finger 106..126 CDD:275368 7/19 (37%)
C2H2 Zn finger 134..155 CDD:275368 5/20 (25%)
C2H2 Zn finger 188..210 CDD:275368 8/80 (10%)
C2H2 Zn finger 217..237 CDD:275368 5/19 (26%)
C2H2 Zn finger 253..276 CDD:275368 5/22 (23%)
C2H2 Zn finger 283..302 CDD:275368 4/18 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.