DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dati and CG2120

DIOPT Version :9

Sequence 1:NP_001245421.1 Gene:dati / 43789 FlyBaseID:FBgn0262636 Length:1150 Species:Drosophila melanogaster
Sequence 2:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster


Alignment Length:418 Identity:82/418 - (19%)
Similarity:126/418 - (30%) Gaps:185/418 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 THQCKPMSPGTVGSSNLGAGRRSAPTTISKTFSQGQQSPQHSTTPSGGSTTPDIKYNNDKMANEI 368
            |..|||               :..|||           .:|.||  |...|.|            
  Fly    78 TDMCKP---------------KRTPTT-----------KRHRTT--GKDHTCD------------ 102

  Fly   369 QLQLSRSSSAAAISERTLEECWSTLQRLFMHKSAMQQIQQQIPRVGLGTHGVTGSANLGGSITPS 433
                        |.:|...|.::    |.:||.               ||               
  Fly   103 ------------ICDRRFSEAYN----LRIHKM---------------TH--------------- 121

  Fly   434 SDTKPHQCQQCMKSFSSNHQLVQHIRVHTGEKPYKCSYCDRRFKQLSHVQQHTRLHTGERPYKCH 498
            :|.|||.|.:|.|.|...::|..|...||.|:|:||..|.:.|:..:::..|.||||||:||.|.
  Fly   122 TDEKPHVCVECGKGFRQLNKLRIHAVTHTAERPHKCDICGKGFRYANYLTVHRRLHTGEKPYPCL 186

  Fly   499 LPDCGRAFIQLSNLQQHLR-NHDAQVERAKNRPFHCNICGKGFATESSLRTHTSKELQLHLGVLQ 562
            ..||..:|..:...:.|.: .|.||.:.....|.                   :::.|.....| 
  Fly   187 ATDCHLSFHSIHARRIHTKLRHAAQTDPDPEHPL-------------------AEQEQRDTSAL- 231

  Fly   563 QHAALIGGPNATSCPVCHKLFLGTEALVDHMKHVHKEKSPPPGGSASSQFSELNQIVTGNGNGTG 627
                      :.:||||.::......|..|:|..:.::..|                        
  Fly   232 ----------SFTCPVCSRVLTDQCYLSIHLKRHYNQRDFP------------------------ 262

  Fly   628 SSNEQIATQCTTESNSHQATVGSSLIDSFLGKRRTANHPCPVCGKHYVNEGSLRKHLACHAENSQ 692
                     |                            |.|.|||.:.:...|:.|...|.:.  
  Fly   263 ---------C----------------------------PQPECGKRFFSASELKHHQIAHTQQ-- 288

  Fly   693 LTNSLRMWPCSVCQAVFTHENGLLTHME 720
                 |.:.|.:|.|.|..::....|::
  Fly   289 -----RPFACPLCPARFLRKSNHKQHLK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
datiNP_001245421.1 COG5048 <429..>511 CDD:227381 31/81 (38%)
C2H2 Zn finger 441..461 CDD:275368 6/19 (32%)
zf-H2C2_2 454..478 CDD:290200 10/23 (43%)
C2H2 Zn finger 469..489 CDD:275368 5/19 (26%)
zf-H2C2_2 481..508 CDD:290200 13/26 (50%)
C2H2 Zn finger 497..519 CDD:275368 5/22 (23%)
C2H2 Zn finger 533..557 CDD:275368 1/23 (4%)
C2H2 Zn finger 576..594 CDD:275368 6/17 (35%)
C2H2 Zn finger 667..687 CDD:275370 6/19 (32%)
C2H2 Zn finger 702..719 CDD:275370 4/16 (25%)
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368 7/62 (11%)
zf-H2C2_2 113..138 CDD:290200 13/58 (22%)
C2H2 Zn finger 129..149 CDD:275368 6/19 (32%)
zf-H2C2_2 142..166 CDD:290200 10/23 (43%)
COG5048 151..>264 CDD:227381 35/203 (17%)
C2H2 Zn finger 157..177 CDD:275368 5/19 (26%)
C2H2 Zn finger 185..206 CDD:275368 5/20 (25%)
C2H2 Zn finger 235..255 CDD:275368 7/19 (37%)
C2H2 Zn finger 263..285 CDD:275368 8/49 (16%)
C2H2 Zn finger 293..313 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.