DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dati and Opbp

DIOPT Version :9

Sequence 1:NP_001245421.1 Gene:dati / 43789 FlyBaseID:FBgn0262636 Length:1150 Species:Drosophila melanogaster
Sequence 2:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster


Alignment Length:549 Identity:118/549 - (21%)
Similarity:182/549 - (33%) Gaps:159/549 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 PSTVSTDDAQSSAPS----------HQLAGTGRALQTHQCKPMSPGTVGSSNLGAGRRSAPTTIS 332
            |:.|..:..|:. ||          |.:.......:.|.|.....|  |||... |...||....
  Fly    99 PANVKAEKDQNE-PSNSDRYFCYDCHSIFENRNKAEEHICPRAESG--GSSQQD-GDAKAPVRRK 159

  Fly   333 KTFSQGQQSPQH-STTPSGG------STTPDIKY----NNDKMANEIQ--LQLSRSSSAAAISER 384
            ......:..|:. |:..|.|      |:...:|:    :.::....||  |.:......:.:.:.
  Fly   160 LASVSARTGPRDASSVISCGICNTVFSSEKFLKFHMRIHENRAPKSIQDALPIGAHQQYSELDQF 224

  Fly   385 TLEECWSTLQR--LFMHKSAMQQIQQQI------------------------PRVGLGTHGVTGS 423
            ..|.|..:...  |.:||...||...:|                        ||....:..:...
  Fly   225 YCEICNKSFDETLLTVHKQMHQQESSEIMCSICNRKFENEVTYQMHQKIHEKPRDSESSRKLAQR 289

  Fly   424 ANLGGSITPSSDTKP-HQCQQCMKSFSSNHQLVQHIRVHTGEKPYKCSYCDRRFKQLSHVQQHTR 487
            .:|       ...|| ..||.|.:.|:...:.|:|.|||||||||.|..|.:.|:....:..|.|
  Fly   290 TSL-------DKEKPGFPCQYCERVFTRPFEKVKHERVHTGEKPYACEVCGKTFRVSYSLTLHLR 347

  Fly   488 LHTGERPYKCHLPDCGRAFIQLSNLQQHLRNHDAQVERAKNRPFHCNICGKGFATESSLRTHTSK 552
            .||..|||.|.:  |.:.|........|||.|.::      |.|.|:.|.|.|.|...|..|.:.
  Fly   348 THTNIRPYVCTV--CNKRFKSHQVYSHHLRIHSSE------RQFSCDACPKTFRTSVQLYAHKNT 404

  Fly   553 ELQLHLGVLQQHAALIGGPNATSCPVCHKLFLGTEALVDHMKHVHKEKSPPPGGSASSQFSELNQ 617
            ..:.:                 .|.||::.|....|:.:||: .|||                  
  Fly   405 HTKPY-----------------RCAVCNRPFSSMYAVKNHMQ-THKE------------------ 433

  Fly   618 IVTGNGNGTGSSNEQIATQCTTESNSHQATVGSSLIDSFLGKRRTANHPCPVCGKHYVNEGSLRK 682
             ::..|: .||....|.:..|::|.:             .||     ..|..||..|....:||.
  Fly   434 -ISSKGS-VGSGTPNIKSAATSKSQA-------------AGK-----FYCNTCGAEYARLFALRL 478

  Fly   683 HL-ACHAENSQLTNSLRMWPCSVCQAVFTHENGLLTHMESMRMDPKHQFAAQYVLSRAAAEQRER 746
            |: :.|                          ||:...|    :|.....|.:|   |..:..|.
  Fly   479 HMKSAH--------------------------GLVEEQE----NPATSTDAAHV---AETDDSET 510

  Fly   747 ESLLAVTLAASSGASTRIGIADAGNVLPT 775
            ..|:|...|.::..:..:...|....:||
  Fly   511 AVLIAAAEADAAYINAVVNDVDIVGTVPT 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
datiNP_001245421.1 COG5048 <429..>511 CDD:227381 30/82 (37%)
C2H2 Zn finger 441..461 CDD:275368 7/19 (37%)
zf-H2C2_2 454..478 CDD:290200 14/23 (61%)
C2H2 Zn finger 469..489 CDD:275368 5/19 (26%)
zf-H2C2_2 481..508 CDD:290200 10/26 (38%)
C2H2 Zn finger 497..519 CDD:275368 6/21 (29%)
C2H2 Zn finger 533..557 CDD:275368 7/23 (30%)
C2H2 Zn finger 576..594 CDD:275368 6/17 (35%)
C2H2 Zn finger 667..687 CDD:275370 7/20 (35%)
C2H2 Zn finger 702..719 CDD:275370 2/16 (13%)
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 0/19 (0%)
C2H2 Zn finger 301..321 CDD:275368 7/19 (37%)
zf-H2C2_2 316..336 CDD:290200 12/19 (63%)
C2H2 Zn finger 329..349 CDD:275368 5/19 (26%)
zf-H2C2_2 341..366 CDD:290200 10/26 (38%)
C2H2 Zn finger 357..377 CDD:275368 6/21 (29%)
C2H2 Zn finger 385..405 CDD:275368 7/19 (37%)
C2H2 Zn finger 411..431 CDD:275368 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.