DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dati and ZNF362

DIOPT Version :9

Sequence 1:NP_001245421.1 Gene:dati / 43789 FlyBaseID:FBgn0262636 Length:1150 Species:Drosophila melanogaster
Sequence 2:NP_001357141.1 Gene:ZNF362 / 149076 HGNCID:18079 Length:420 Species:Homo sapiens


Alignment Length:410 Identity:131/410 - (31%)
Similarity:174/410 - (42%) Gaps:97/410 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 PKQEMDAKTPLQPLDECP--HPLVQAQAQSQYGGDYYDVADPQAREISEGRALIIGLG-APSTVS 282
            |.:...|...|..|.:.|  ||  ||..|.       ||| ..||..:   :.:.||| :..|.|
Human    75 PAESSQAVMSLPKLQQVPGLHP--QAVPQP-------DVA-LHARPAT---STVTGLGLSTRTPS 126

  Fly   283 TDDAQSSAPSHQLAGTGRALQTHQCKPMSPGTVGSSNLGAGRRSAPTTIS-----------KTF- 335
            ...::|||.    ||||....|    |.:|.|...|.|.|   |:||.||           ||. 
Human   127 VSTSESSAG----AGTGTGTST----PSTPTTTSQSRLIA---SSPTLISGITSPPLLDSIKTIQ 180

  Fly   336 SQGQQSPQHSTTPSGGSTTPDIKYNNDKMANEIQLQLSRSSSAAAISERTLEECWSTLQRLFMHK 400
            ..|...|     |........||..|......:.:.....:|.....|.....| ......|..|
Human   181 GHGLLGP-----PKSERGRKKIKAENPGGPPVLVVPYPILASGETAKEGKTYRC-KVCPLTFFTK 239

  Fly   401 SAMQQIQQQIPRVGLGTHGVTGSANLGGSITPSSDTKPHQCQQCMKSFSSNHQLVQHIRVHTGEK 465
            |.||        :...:|               ::.|||:|..|.|||::...|.||:|:|.|.|
Human   240 SEMQ--------IHSKSH---------------TEAKPHKCPHCSKSFANASYLAQHLRIHLGVK 281

  Fly   466 PYKCSYCDRRFKQLSHVQQHTRLHTGERPYKCHLPDCGRAFIQLSNLQQHLRNHDAQVERAKNRP 530
            ||.|||||:.|:||||:|||||:|||:|||||..|.|.:||.||||||.|.|.|:      |::|
Human   282 PYHCSYCDKSFRQLSHLQQHTRIHTGDRPYKCPHPGCEKAFTQLSNLQSHQRQHN------KDKP 340

  Fly   531 FHCNICGKGFATESSLRTHTSKELQLHLGVLQQHAALIGGPNATSCPVCHKLFLGTEALVDHM-- 593
            :.|..|.:.::..:||:.|           |..||  |....|..|.:|.:.:.....|:.||  
Human   341 YKCPNCYRAYSDSASLQIH-----------LSAHA--IKHAKAYCCSMCGRAYTSETYLMKHMSK 392

  Fly   594 ----KHVHKEKSP----PPG 605
                :|:....||    .||
Human   393 HTVVEHLVSHHSPQRTESPG 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
datiNP_001245421.1 COG5048 <429..>511 CDD:227381 46/81 (57%)
C2H2 Zn finger 441..461 CDD:275368 9/19 (47%)
zf-H2C2_2 454..478 CDD:290200 15/23 (65%)
C2H2 Zn finger 469..489 CDD:275368 15/19 (79%)
zf-H2C2_2 481..508 CDD:290200 18/26 (69%)
C2H2 Zn finger 497..519 CDD:275368 13/21 (62%)
C2H2 Zn finger 533..557 CDD:275368 5/23 (22%)
C2H2 Zn finger 576..594 CDD:275368 5/23 (22%)
C2H2 Zn finger 667..687 CDD:275370
C2H2 Zn finger 702..719 CDD:275370
ZNF362NP_001357141.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
PRK14971 <27..>125 CDD:237874 18/62 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 54..80 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..155 16/47 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..202 6/28 (21%)
C2H2 Zn finger 229..249 CDD:275368 6/28 (21%)
zf-H2C2_2 241..266 CDD:372612 11/47 (23%)
zf-C2H2 255..277 CDD:333835 10/21 (48%)
C2H2 Zn finger 257..277 CDD:275368 9/19 (47%)
zf-H2C2_2 269..294 CDD:372612 15/24 (63%)
C2H2 Zn finger 285..305 CDD:275368 15/19 (79%)
SFP1 <307..359 CDD:227516 25/57 (44%)
C2H2 Zn finger 313..335 CDD:275368 13/21 (62%)
C2H2 Zn finger 343..363 CDD:275368 6/30 (20%)
C2H2 Zn finger 375..393 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I12015
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.