DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hcf and KLHDC4

DIOPT Version :9

Sequence 1:NP_524621.2 Gene:Hcf / 43788 FlyBaseID:FBgn0039904 Length:1500 Species:Drosophila melanogaster
Sequence 2:XP_006721264.1 Gene:KLHDC4 / 54758 HGNCID:25272 Length:525 Species:Homo sapiens


Alignment Length:450 Identity:109/450 - (24%)
Similarity:160/450 - (35%) Gaps:138/450 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 PQPRPRHGHRAINI---KELMVVFGG----GNEG-IVDELHVYNTVTNQWYVPVLKGDVPNGCAA 125
            |.|.||. :.::::   |:.:::|||    |.:. :.:||:||||..:.|....:....|..||.
Human    59 PPPSPRL-NASLSVHPEKDELILFGGEYFNGQKTFLYNELYVYNTRKDTWTKVDIPSPPPRRCAH 122

  Fly   126 YGFVVE--GTRMFVFGGMIEYGKYSNE-------LYELQ-ATK-WEWRKMYPESPDSGLSPCPRL 179
            ...||.  |.:::||||  |:...:.|       |:.|. ||| ||...::......|  |..|.
Human   123 QAVVVPQGGGQLWVFGG--EFASPNGEQFYHYKDLWVLHLATKTWEQVNLFHFRSTGG--PSGRS 183

  Fly   180 GHSFTMVGEKIFLFGGLANESDDPKNNIPKYLNDLYI--LDTRGVHSHNGKWIVPKTYGDSPPPR 242
            ||.......::.||||....:.|     ..|.||:|.  |||       ..|......|..|.||
Human   184 GHRMVAWKRQLILFGGFHESTRD-----YIYYNDVYAFNLDT-------FTWSKLSPSGTGPTPR 236

  Fly   243 ESHTGISFATKSNGNLNLLIYGGMS----------GCRLGDLWLLE-----TDSMTWSKPKTSGE 292
               :|...:....|  .:::|||.|          |.|..|::||:     .|...|::...||.
Human   237 ---SGCQMSVTPQG--GIVVYGGYSKQRVKKDVDKGTRHSDMFLLKPEDGREDKWVWTRMNPSGV 296

  Fly   293 APLPRSLHSSTMIGNKMYVFGGWVPLVINDSKSTTEREWKCTNTLAVLDLETMTW---------- 347
            .|.|||..|..|..|...:|.|.|    .|.:.......:..|.|...|.....|          
Human   297 KPTPRSGFSVAMAPNHQTLFFGGV----CDEEEEESLSGEFFNDLYFYDATRNRWFEGQLKGPKS 357

  Fly   348 --------------------------------------ENVTLDTVEE--------NVPRA---- 362
                                                  |:.|:.|:::        ..||:    
Human   358 EKKKRRRGRKEEPEGGSRPACGGAGTQGPVQLVKEVVAEDGTVVTIKQVLTAPGSAGQPRSEDED 422

  Fly   363 ---RAGHCAVGIQSR-----------LYVWSG--RDGYRKAWNNQVCCKDLWYLEVSKPL 406
               .||..|.|...|           |||:.|  ..|.|:...:.:.|.||..:|..|.|
Human   423 SLEEAGSPAPGPCPRSNAMLAVKHGVLYVYGGMFEAGDRQVTLSDLHCLDLHRMEAWKAL 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HcfNP_524621.2 Kelch_1 73..110 CDD:279660 13/44 (30%)
KELCH repeat 74..115 CDD:276965 13/48 (27%)
KELCH repeat 123..175 CDD:276965 19/62 (31%)
Kelch_3 132..184 CDD:290151 19/60 (32%)
Kelch_5 175..221 CDD:290565 16/47 (34%)
KELCH repeat 178..239 CDD:276965 17/62 (27%)
Kelch_3 260..305 CDD:290151 18/59 (31%)
KELCH repeat 297..360 CDD:276965 16/118 (14%)
Kelch_3 306..371 CDD:290151 17/127 (13%)
FN3 <1307..1338 CDD:238020
FN3 1344..1448 CDD:238020
KLHDC4XP_006721264.1 KELCH repeat 64..115 CDD:276965 13/51 (25%)
PLN02193 <77..319 CDD:330882 75/262 (29%)
KELCH repeat 119..179 CDD:276965 19/63 (30%)
KELCH repeat 182..231 CDD:276965 16/60 (27%)
KELCH repeat 236..298 CDD:276965 16/66 (24%)
KELCH repeat 437..485 CDD:276965 12/45 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1494
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.